[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : gp36
DDBJ      :gp36         phage phi-C31 major capsid gp36-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
d.183.1
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   162->419 3e8kG PDBj 3e-30 17.6 %
:RPS:SCOP  125->419 1ohgA  d.183.1.1 * 7e-32 17.2 %
:HMM:SCOP  126->419 1ohgA_ d.183.1.1 * 1e-71 39.7 %
:RPS:PFM   135->417 PF05065 * Phage_capsid 6e-25 37.3 %
:HMM:PFM   134->419 PF05065 * Phage_capsid 1.1e-72 41.1 263/276  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86763.1 GT:GENE gp36 GT:PRODUCT phage phi-C31 major capsid gp36-like protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 946037..947305 GB:FROM 946037 GB:TO 947305 GB:DIRECTION + GB:GENE gp36 GB:PRODUCT phage phi-C31 major capsid gp36-like protein GB:PROTEIN_ID AAK86763.1 GB:DB_XREF GI:15155961 GB:GENE:GENE gp36 LENGTH 422 SQ:AASEQ MTDQMTTPAPMTVAPQVKAVPDTVTAAFDDFMEAFEAFRETNDQRLADIERKMGSDVVTRDKLDRIDKALDDNRMIMDDLALKKARPALGRKDGISHDAGEHKAAFEAYIRRGEEGALRDLEAKAFAGSTGTDGGFLLPSETDGEIGRRMTAISPIRALATVRQVSAAVLKKPFALGGMTTGWVSETAARPQTATPQLAELSFPTMELYAMPAATQGLLDDAAVDIEAWIASEVDIAFAEQEAAAFIAGDGVNKPKGFLSYTAIANDGWNWGNIGYVATGVSAGFASAGPMDVLLDAVYALKAGHRQNGTFLMNRKTQGALRRFKDTSGAYLWHPPAAAGQPASLMGFPVTEAEDMPGVAANSFAIAFGDFRAGYLVVDRTGVRILRDPYSAKPYVLFYTTKRVGGGVQNFEAIKLVKFGVN GT:EXON 1|1-422:0| SEG 26->38|aafddfmeafeaf| SEG 236->248|iafaeqeaaafia| RP:PDB:NREP 1 RP:PDB:REP 162->419|3e8kG|3e-30|17.6|238/247| RP:PFM:NREP 1 RP:PFM:REP 135->417|PF05065|6e-25|37.3|263/271|Phage_capsid| HM:PFM:NREP 1 HM:PFM:REP 134->419|PF05065|1.1e-72|41.1|263/276|Phage_capsid| RP:SCP:NREP 1 RP:SCP:REP 125->419|1ohgA|7e-32|17.2|273/280|d.183.1.1| HM:SCP:REP 126->419|1ohgA_|1e-71|39.7|272/0|d.183.1.1|1/1|Major capsid protein gp5| OP:NHOMO 138 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------------------------- -------------------------------------2---------------------------------------------------------------------------------------------------------1--------------------------------------------------------1------------------------------------------------------------1------------------1-----------------------1-------------------1-------------1-22------1-----2------1----1---------211-----------54211111111-111-11--11-11-21111--113------1-121-11112221111----------------111111111111--11--2------1-11-11-1-----------------11-------1-------------1--------------------------1---------------111------------------------1---1--------------------------------------------------2----------------11--1-2-------2-1-1--11-----1--------1---11----------------1------------------------------1--1----------------------------------1---------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------1---------------------------------------1------------------------------------------------------1-1------------------------- STR:NPRED 257 STR:RPRED 60.9 SQ:SECSTR ##############################################################################################################################################################cccccccTTGGGcEEEEccccEEEEEEEEcccccccccEEEEEEEEcEEEEEEEEEcTTTTccHH#HHHHHTTTTHHHHHHHHHHHHHHcccccTTccccHHHHcEEccGcccHHHTTcccccGGccTTccHHHHHHHHHHHHHTTTccccEEEccTTTTHHHHTcEETTTEEcccccHccccccccTTccccccTTcc###TTEEcEEEEcHHHHcEEEEEEEEEEEEEcccTTTTEEEEEEEEEEEccccGGGEEEEEc### DISOP:02AL 1-8, 45-55, 80-100, 123-127| PSIPRED cccccccHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEcccEEEEEEEEcccEEEEEcccccccccccccccEEEEcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEccccccccHHccHHHHHHHHHHHcHHHHcccEEEEcHHHHHHHHHHHcccccEEEccccccccccEEccccEEEEccccccccccEEEEEEEccccEEEEEEEccEEEEEccccccEEEEEEEEEEccEEEccccEEEEEEEcc //