[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : grlA
DDBJ      :grlA         glutaredoxin-related protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  467/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->105 2wemC PDBj 3e-27 62.7 %
:RPS:PDB   15->97 3cseA PDBj 3e-20 21.0 %
:RPS:SCOP  2->104 1wikA  c.47.1.1 * 8e-21 42.7 %
:HMM:SCOP  1->109 1wikA_ c.47.1.1 * 7.8e-34 39.4 %
:RPS:PFM   17->81 PF00462 * Glutaredoxin 3e-11 41.7 %
:HMM:PFM   17->81 PF00462 * Glutaredoxin 1.2e-21 40.0 60/60  
:BLT:SWISS 8->97 YC64L_SYNY3 2e-31 62.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87621.2 GT:GENE grlA GT:PRODUCT glutaredoxin-related protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1834234..1834569 GB:FROM 1834234 GB:TO 1834569 GB:DIRECTION + GB:GENE grlA GB:PRODUCT glutaredoxin-related protein GB:PROTEIN_ID AAK87621.2 GB:DB_XREF GI:159140225 GB:GENE:GENE grlA LENGTH 111 SQ:AASEQ MSGIHDIIDSEVKSNDIVLFLKGTPQFPQCGFSGQVVQILDYLGVEYKGVNVLADADIRQGIKDYSNWPTIPQLYIKGEFVGGCDIVKEMFQSGELQSHFQEQGISVRGAA GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 8->97|YC64L_SYNY3|2e-31|62.2|90/107| BL:PDB:NREP 1 BL:PDB:REP 23->105|2wemC|3e-27|62.7|83/109| RP:PDB:NREP 1 RP:PDB:REP 15->97|3cseA|3e-20|21.0|81/225| RP:PFM:NREP 1 RP:PFM:REP 17->81|PF00462|3e-11|41.7|60/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 17->81|PF00462|1.2e-21|40.0|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 2->104|1wikA|8e-21|42.7|103/109|c.47.1.1| HM:SCP:REP 1->109|1wikA_|7.8e-34|39.4|109/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 994 OP:NHOMOORG 667 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-1111111111111111111111112211111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111---------------------------12---------------------------111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111211111111111111211111111111111111111111111122222222222222111-111111------------------------------------------------- 3311222-93312221222222222222222222222212221222122233221222222221222222341223322322222222-232222232222223221272412222-21-2221222423C2-235111-22222211-122222232222422222222723532435Q4444485A62453342233 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 100.0 SQ:SECSTR cGGHHHHHHHHcccccEEEEEEEETTTTEEEcTTccccccHHHHHHHHHHHHccccTTcEEEEEHHHHHHccGGGcTTccTTcEEEEEcTTcccccEHHHTcccccTTcTT DISOP:02AL 1-1,106-112| PSIPRED cHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHcccHHHHHHHcccHHcccc //