[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : grpE
DDBJ      :grpE         GRPE protein
Swiss-Prot:GRPE_RHIRD   RecName: Full=Protein grpE;AltName: Full=HSP-70 cofactor;

Homologs  Archaea  18/68 : Bacteria  801/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
b.73.1d.58.61h.1.9
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->188 1dkgA PDBj 5e-24 41.7 %
:RPS:PDB   40->189 1dkgB PDBj 6e-46 41.3 %
:RPS:SCOP  63->139 2raqA1  d.58.61.1 * 3e-13 15.3 %
:RPS:SCOP  133->190 1dkgA1  b.73.1.1 * 2e-22 39.7 %
:HMM:SCOP  35->132 1dkgB2 h.1.9.1 * 2.4e-24 49.5 %
:HMM:SCOP  133->191 1dkgA1 b.73.1.1 * 2.1e-18 52.5 %
:RPS:PFM   35->187 PF01025 * GrpE 6e-31 52.4 %
:HMM:PFM   23->188 PF01025 * GrpE 1e-56 46.2 156/166  
:BLT:SWISS 1->211 GRPE_RHIRD e-110 100.0 %
:PROS 143->186|PS01071|GRPE
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86146.1 GT:GENE grpE GT:PRODUCT GRPE protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 323105..323740 GB:FROM 323105 GB:TO 323740 GB:DIRECTION + GB:GENE grpE GB:PRODUCT GRPE protein GB:PROTEIN_ID AAK86146.1 GB:DB_XREF GI:15155235 GB:GENE:GENE grpE LENGTH 211 SQ:AASEQ MTDDTKKPGPDADVAEEFVDPAQAGEEQAETAEPDPVELLKAENADLRDKFLRLAAEMDNLRRRTERDVKDAKAYSLAGFARDMLAVSDNLRRALEAIPDELKTNGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEGQKFDPNFHQAMFEVPNTAVPNNTVLQVIQAGFTIGDRVLRPAMVGVAKGGPKAEPSASAEPGTSSLNEKDA GT:EXON 1|1-211:0| SW:ID GRPE_RHIRD SW:DE RecName: Full=Protein grpE;AltName: Full=HSP-70 cofactor; SW:GN Name=grpE; SW:KW Chaperone; Cytoplasm; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->211|GRPE_RHIRD|e-110|100.0|211/211| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 143->186|PS01071|GRPE|PDOC00822| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 37->65| SEG 22->33|aqageeqaetae| BL:PDB:NREP 1 BL:PDB:REP 38->188|1dkgA|5e-24|41.7|139/158| RP:PDB:NREP 1 RP:PDB:REP 40->189|1dkgB|6e-46|41.3|138/151| RP:PFM:NREP 1 RP:PFM:REP 35->187|PF01025|6e-31|52.4|147/180|GrpE| HM:PFM:NREP 1 HM:PFM:REP 23->188|PF01025|1e-56|46.2|156/166|GrpE| GO:PFM:NREP 6 GO:PFM GO:0000774|"GO:adenyl-nucleotide exchange factor activity"|PF01025|IPR000740| GO:PFM GO:0005739|"GO:mitochondrion"|PF01025|IPR000740| GO:PFM GO:0006457|"GO:protein folding"|PF01025|IPR000740| GO:PFM GO:0030150|"GO:protein import into mitochondrial matrix"|PF01025|IPR000740| GO:PFM GO:0042803|"GO:protein homodimerization activity"|PF01025|IPR000740| GO:PFM GO:0051087|"GO:chaperone binding"|PF01025|IPR000740| RP:SCP:NREP 2 RP:SCP:REP 63->139|2raqA1|3e-13|15.3|72/93|d.58.61.1| RP:SCP:REP 133->190|1dkgA1|2e-22|39.7|58/59|b.73.1.1| HM:SCP:REP 35->132|1dkgB2|2.4e-24|49.5|93/0|h.1.9.1|1/1|Coiled-coil domain of nucleotide exchange factor GrpE| HM:SCP:REP 133->191|1dkgA1|2.1e-18|52.5|59/59|b.73.1.1|1/1|Head domain of nucleotide exchange factor GrpE| OP:NHOMO 1119 OP:NHOMOORG 1009 OP:PATTERN ---------------------------1-1--111--------2211111111---------1---11 111-11-----11------------1------------1--1--111--11-111-11-----1-112111-------1111111111111111111--11-111111111------1111111111111111111111111111-1111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111-11111111111111111121111111111111111111-1111211111112111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121-111111111111111111111111111111111111111111111111111111111111111-111111-----11111111111111-11-111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-------111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11------------1-----------------111 1111111-521-111111-111111111111111111111111111111111111111111111111111111111111111111111-12111111111111211--512111-23222122222131352-233121221231211212123222221111111-121111122322F2222243451621111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 70.6 SQ:SECSTR #####################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHH####EEEEEEHHHHHHHHHHHHHHHHHTTTEEEEccccccccTTTEEEEEEEEcccccTTcEEEEcccEEEETTEEEEcEEEEEEEcc##################### DISOP:02AL 1-4, 8-34, 102-104, 187-211| PSIPRED ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHccccccccccEEEEEEEccEEEccEEEccEEEEEEcccccccccccccccccccccccc //