[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : guaA.2
DDBJ      :guaA         GMP synthase
Swiss-Prot:GUAA_AGRT5   RecName: Full=GMP synthase [glutamine-hydrolyzing];         EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase;

Homologs  Archaea  64/68 : Bacteria  850/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.26.2d.52.2
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->525 1gpmA PDBj e-153 55.2 %
:RPS:PDB   10->205 2a9vB PDBj 2e-40 27.2 %
:RPS:PDB   211->525 2dplA PDBj 5e-57 55.6 %
:RPS:SCOP  6->201 1gpmA2  c.23.16.1 * 3e-43 47.4 %
:RPS:SCOP  196->493 1q15A1  c.26.2.1 * 3e-35 14.4 %
:HMM:SCOP  8->232 1l9xA_ c.23.16.1 * 3.2e-58 36.5 %
:HMM:SCOP  192->418 1jgtA1 c.26.2.1 * 1.6e-60 42.0 %
:HMM:SCOP  405->525 1gpmA3 d.52.2.1 * 7e-50 66.1 %
:RPS:PFM   12->192 PF00117 * GATase 4e-22 37.6 %
:RPS:PFM   213->402 PF02540 * NAD_synthase 4e-09 32.5 %
:RPS:PFM   435->524 PF00958 * GMP_synt_C 1e-30 70.5 %
:HMM:PFM   433->524 PF00958 * GMP_synt_C 6.7e-41 59.8 92/93  
:HMM:PFM   11->195 PF00117 * GATase 1.2e-39 35.5 183/192  
:HMM:PFM   373->402 PF02540 * NAD_synthase 0.00023 40.0 30/242  
:HMM:PFM   224->253 PF03054 * tRNA_Me_trans 1.1e-07 55.2 29/356  
:BLT:SWISS 1->525 GUAA_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86096.1 GT:GENE guaA.2 GT:PRODUCT GMP synthase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(275073..276650) GB:FROM 275073 GB:TO 276650 GB:DIRECTION - GB:GENE guaA GB:PRODUCT GMP synthase GB:PROTEIN_ID AAK86096.1 GB:DB_XREF GI:15155177 GB:GENE:GENE guaA LENGTH 525 SQ:AASEQ MTQIAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEAFEKLQPKGVIFSGGPASVTAEGSPRAPQAVFDSKVPILGICYGQQTLCTQLGGVVEGGHAAEFGRADIDIKKASPLFEGFWEQGKSYPVWMSHGDRVTKLPEGFEVIATSENAPFAIAADEKRHYYTTMFHPEVVHTPDGGKLLSNFVHKIVGLKSDWTMAAYRAEMIRKIREQVGTGRVLCALSGGVDSSVAAILIHEAIGDQLTCVYVDHGLMRLGESEQVVGMFRDHYNIPLVHVDAADLFLGELSGVSDPEVKRKTIGRLFIEVFEAEAAKIAADGKGAPKFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMQLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGAITREKLDILRKADAIYLDEIRKAGLYDTIWQAFAVLLPVQTVGVMGDYRTYDFVCALRAVTSVDGMTADFYPYDMNFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE GT:EXON 1|1-525:0| SW:ID GUAA_AGRT5 SW:DE RecName: Full=GMP synthase [glutamine-hydrolyzing]; EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase; SW:GN Name=guaA; OrderedLocusNames=Atu0281; ORFNames=AGR_C_480; SW:KW ATP-binding; Complete proteome; Glutamine amidotransferase;GMP biosynthesis; Ligase; Nucleotide-binding; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->525|GUAA_AGRT5|0.0|100.0|525/525| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0006177|"GO:GMP biosynthetic process"|GMP biosynthesis| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 6->525|1gpmA|e-153|55.2|493/501| RP:PDB:NREP 2 RP:PDB:REP 10->205|2a9vB|2e-40|27.2|191/195| RP:PDB:REP 211->525|2dplA|5e-57|55.6|279/287| RP:PFM:NREP 3 RP:PFM:REP 12->192|PF00117|4e-22|37.6|178/185|GATase| RP:PFM:REP 213->402|PF02540|4e-09|32.5|166/208|NAD_synthase| RP:PFM:REP 435->524|PF00958|1e-30|70.5|88/93|GMP_synt_C| HM:PFM:NREP 4 HM:PFM:REP 433->524|PF00958|6.7e-41|59.8|92/93|GMP_synt_C| HM:PFM:REP 11->195|PF00117|1.2e-39|35.5|183/192|GATase| HM:PFM:REP 373->402|PF02540|0.00023|40.0|30/242|NAD_synthase| HM:PFM:REP 224->253|PF03054|1.1e-07|55.2|29/356|tRNA_Me_trans| GO:PFM:NREP 8 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| GO:PFM GO:0003952|"GO:NAD+ synthase (glutamine-hydrolyzing) activity"|PF02540|IPR003694| GO:PFM GO:0005524|"GO:ATP binding"|PF02540|IPR003694| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02540|IPR003694| GO:PFM GO:0003922|"GO:GMP synthase (glutamine-hydrolyzing) activity"|PF00958|IPR001674| GO:PFM GO:0005524|"GO:ATP binding"|PF00958|IPR001674| GO:PFM GO:0006164|"GO:purine nucleotide biosynthetic process"|PF00958|IPR001674| GO:PFM GO:0006177|"GO:GMP biosynthetic process"|PF00958|IPR001674| RP:SCP:NREP 2 RP:SCP:REP 6->201|1gpmA2|3e-43|47.4|196/205|c.23.16.1| RP:SCP:REP 196->493|1q15A1|3e-35|14.4|277/287|c.26.2.1| HM:SCP:REP 8->232|1l9xA_|3.2e-58|36.5|222/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| HM:SCP:REP 192->418|1jgtA1|1.6e-60|42.0|226/299|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 405->525|1gpmA3|7e-50|66.1|121/0|d.52.2.1|1/1|GMP synthetase C-terminal dimerisation domain| OP:NHOMO 1394 OP:NHOMOORG 1104 OP:PATTERN 1112--3222222223-311111322223313322222223232212323222232222222221-22 1111111111111111111-1111111111111111111111111111111111111111111111111111111111112211111111221211---111111111111-------111111-111121121211111122212112111111111111111111111121112221211231211211111222221221222222111111222111123122222211111111111111111111111111111-1112211111111-12331111111222222222222221111111122211211222111122122111111111121211111212111221111111111111112111111111211111111111112111111111111111-11111111221112221111111111211111111211111111111111111111111111111---------------111111111111111111111111111111111111111111111111212211111121111111111111111111111122211211111111111122112111111122221222222121212222212122111121111212122222212222221232211-11111------11111211111111111-111111111111111111111111221111111111111111111111111111111111111111122221221111111121111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111-1-1------1------1------1------1-11121222122 1111111-311-11111111111111111111111111211121111112112111111111111111111112111-1121111112-11111131111111112-1212111111112111112-11251-11211111-1111111-1111111112641111111123322111191111111121221133221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 524 STR:RPRED 99.8 SQ:SECSTR #EccGccccEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccEEEEccccccGGGTGGGHHHHHHHHHHccccEEEEEEccccHHHHHHcTTcccccccccccEEEEETTEEEEEcccccccccccEEEEEEEEHHHHHHHHHHcHHHHHHHHHTHHHHHccEEEEEccccccccccccccccccTTccccHHHHHHHHHHHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHHGGGEEEEEEEcccccTTHHHHHHHHHTTTTccEEEEEEcHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHTccTTTcHTEEEcccccccHHHHHTEEEEEcHccHHHHTcccccccTccEEEcTTTTccHHHHHHHHHHTTccHHHHTcccccTTGGGGGccccccHHHHHHHHHHHHHHHHHHHHTTccHHccEEEEEEccccEEEEccccEEEEEEEEEEEEEcccccccEEccccHHHHHHHHHHHHHHcTTEEEEEEcccccTTcccccc DISOP:02AL 1-5, 203-218| PSIPRED ccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccEEEEccccccccccccHHHHHHHHHccccEEEEEHHHHHHHHHcccEEEEccccEEcccccEEccccccccccccccccEEEEEEccEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHccccEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHccccccccccccccccccccccHHHcccEEEccHHHccHHHHHHHHHHccccHHHHcccccccccEEEEEcccccHHHHHHHHHccHHHHHHHHHcccccccEEEEEEEcccEEEEEEcccEEEccEEEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccc //