[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisA
DDBJ      :hisA         phosphoribosylformino-5-aminoimidazole carboxamide ribotide isomerase
Swiss-Prot:HIS4_AGRT5   RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase;         EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase;

Homologs  Archaea  55/68 : Bacteria  714/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->237 2vepA PDBj 2e-29 34.9 %
:RPS:PDB   1->246 2a0nA PDBj 4e-24 22.5 %
:RPS:SCOP  2->240 1qo2A  c.1.2.1 * 1e-70 28.3 %
:HMM:SCOP  1->240 1qo2A_ c.1.2.1 * 1.8e-68 46.2 %
:RPS:PFM   3->231 PF00977 * His_biosynth 9e-36 42.2 %
:HMM:PFM   3->230 PF00977 * His_biosynth 1.1e-77 44.2 224/228  
:BLT:SWISS 1->247 HIS4_AGRT5 e-138 100.0 %
:REPEAT 2|36->108|152->223

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85864.1 GT:GENE hisA GT:PRODUCT phosphoribosylformino-5-aminoimidazole carboxamide ribotide isomerase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(41891..42634) GB:FROM 41891 GB:TO 42634 GB:DIRECTION - GB:GENE hisA GB:PRODUCT phosphoribosylformino-5-aminoimidazole carboxamide ribotide isomerase GB:PROTEIN_ID AAK85864.1 GB:DB_XREF GI:15154903 GB:GENE:GENE hisA LENGTH 247 SQ:AASEQ MILFPAIDLKDGECVRLKLGDMEQATVYNEDPGAQAKAFEDQGFEWLHVVDLNGAFAGETVNGAAVDAILKSTKNPVQLGGGIRTLDHIEAWLSRGLARVILGTVAVRDPVLVIEACKRFPGQVAVGIDAKGGKVAVEGWAEASELGIIELAKRFEGAGVAAIIYTDIDRDGILAGINWASTLELADAVSIPVIASGGLASIDDIKRMLQPDAAKLEGAISGRALYDGRIDPTEALDLIKAAKEVRA GT:EXON 1|1-247:0| SW:ID HIS4_AGRT5 SW:DE RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; SW:GN Name=hisA; OrderedLocusNames=Atu0040; ORFNames=AGR_C_63; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->247|HIS4_AGRT5|e-138|100.0|247/247| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| NREPEAT 1 REPEAT 2|36->108|152->223| BL:PDB:NREP 1 BL:PDB:REP 3->237|2vepA|2e-29|34.9|232/240| RP:PDB:NREP 1 RP:PDB:REP 1->246|2a0nA|4e-24|22.5|240/251| RP:PFM:NREP 1 RP:PFM:REP 3->231|PF00977|9e-36|42.2|225/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 3->230|PF00977|1.1e-77|44.2|224/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 2->240|1qo2A|1e-70|28.3|237/241|c.1.2.1| HM:SCP:REP 1->240|1qo2A_|1.8e-68|46.2|238/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1513 OP:NHOMOORG 774 OP:PATTERN ---2--2111111122-2222222222222222222223222222222322222-2-222-2----12 2222212222222222222-22222222222221112222222122222222222222--122122222222222222--22222222222222-----2-222222223---------------222122223222222233322222322222222223222222222223222223233222222222222222222222222222222222222222122221122221-22222222222222222-2----22-2---22--22----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--2212222222222222222--22122222-----222222322222222222222222122222222222-2222222222222222222222222332222222222222222-----------------------------222222222222222222222222222222222222222222222222223222323222222222222222222221423-222222222-2223223222222223342222333333-2-------22222221121222212211111121111111111111--222211122222221222222222222-2222222222222222222222223322222222222222222222222221-11111111111111-2-----332322221221222-2221---2222222222222323222222222222222--------211121111122124112222222222222222223322--------------------------------------2--2-222221 -------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------2-1---------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTEETTccccTHHHTcccTTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEETTEEEEEETTTTEEEEEEHHHHHHHHHHTTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHcHHHHHHHTTccEEEEcHHHHTTcccHHHHHHHHHHTTcccE DISOP:02AL 246-247| PSIPRED cEEEEEEEEcccEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcHHHHccHHHHHHHHHHccccEEEEEEccccEEEEEcccccccccHHHHHHHHHHccccEEEEEcccHHHccccccHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccccEEEEEHHHHcccccHHHHHHHHHccccccc //