[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisB
DDBJ      :hisB         imidazoleglycerol-phosphate dehydratase
Swiss-Prot:HIS7_AGRT5   RecName: Full=Imidazoleglycerol-phosphate dehydratase;         Short=IGPD;         EC=4.2.1.19;

Homologs  Archaea  55/68 : Bacteria  713/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->185 2f1dA PDBj 1e-54 51.1 %
:RPS:PDB   9->181 2ae8A PDBj 5e-49 44.5 %
:RPS:SCOP  2->88 1rhyA1  d.14.1.9 * 1e-29 40.7 %
:RPS:SCOP  89->180 1rhyA2  d.14.1.9 * 8e-21 43.5 %
:HMM:SCOP  3->88 2f1dA1 d.14.1.9 * 6.1e-38 60.5 %
:HMM:SCOP  89->182 1rhyA2 d.14.1.9 * 5.1e-33 56.4 %
:RPS:PFM   33->177 PF00475 * IGPD 3e-50 60.0 %
:HMM:PFM   33->177 PF00475 * IGPD 2.4e-67 56.6 145/145  
:BLT:SWISS 1->198 HIS7_AGRT5 e-112 100.0 %
:PROS 63->76|PS00954|IGP_DEHYDRATASE_1
:PROS 158->170|PS00955|IGP_DEHYDRATASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85867.2 GT:GENE hisB GT:PRODUCT imidazoleglycerol-phosphate dehydratase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(43805..44401) GB:FROM 43805 GB:TO 44401 GB:DIRECTION - GB:GENE hisB GB:PRODUCT imidazoleglycerol-phosphate dehydratase GB:PROTEIN_ID AAK85867.2 GB:DB_XREF GI:159139474 GB:GENE:GENE hisB LENGTH 198 SQ:AASEQ MAERKGEIIRKTNETSVSVRVDIDGTGKSKISTGVGFFDHMLDQLSRHSLIDMDIEVQGDLHIDDHHTVEDTGIAIGQAIAKALGDRRGITRYASLDLAMDETMTKAAVDISGRPFLVWNVNFSAPKIGTFDTELVREFFQALAQNAGITLHILNHYGANNHHIAETCFKAVARVLRTATEIDPRQAGRVPSTKGMLA GT:EXON 1|1-198:0| SW:ID HIS7_AGRT5 SW:DE RecName: Full=Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC=4.2.1.19; SW:GN Name=hisB; OrderedLocusNames=Atu0043; ORFNames=AGR_C_69; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|HIS7_AGRT5|e-112|100.0|198/198| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 63->76|PS00954|IGP_DEHYDRATASE_1|PDOC00738| PROS 158->170|PS00955|IGP_DEHYDRATASE_2|PDOC00738| BL:PDB:NREP 1 BL:PDB:REP 4->185|2f1dA|1e-54|51.1|182/183| RP:PDB:NREP 1 RP:PDB:REP 9->181|2ae8A|5e-49|44.5|164/166| RP:PFM:NREP 1 RP:PFM:REP 33->177|PF00475|3e-50|60.0|145/145|IGPD| HM:PFM:NREP 1 HM:PFM:REP 33->177|PF00475|2.4e-67|56.6|145/145|IGPD| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00475|IPR000807| GO:PFM GO:0004424|"GO:imidazoleglycerol-phosphate dehydratase activity"|PF00475|IPR000807| RP:SCP:NREP 2 RP:SCP:REP 2->88|1rhyA1|1e-29|40.7|81/86|d.14.1.9| RP:SCP:REP 89->180|1rhyA2|8e-21|43.5|92/94|d.14.1.9| HM:SCP:REP 3->88|2f1dA1|6.1e-38|60.5|86/0|d.14.1.9|1/2|Ribosomal protein S5 domain 2-like| HM:SCP:REP 89->182|1rhyA2|5.1e-33|56.4|94/0|d.14.1.9|2/2|Ribosomal protein S5 domain 2-like| OP:NHOMO 915 OP:NHOMOORG 887 OP:PATTERN ---1--1111111111-1111111111111111111111111111111211111-1-111-1----11 1111111111111111111-11111111111111111111121111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111111111111111-1111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1111111111111111111111111111111--------111111111111111111111111111111111111111--------------------------------------1--1-111111 ------1-----221-1111111121111111111111111111111111111111111111111111111111-111--11111111-12111111111111111-11-------------------------------------------------1----2-1-------1-1111D111-111131312112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 92.9 SQ:SECSTR #cccEEEEEEEEEccEEEEEEETccccccEEEcccHHHHHHHHHHHHHHccEEEEEEEccTcccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEETTEEEEEEEEcccccEEEEEccccccEETTEETTHHHHHHHHHHHHTTcEEEEEEEEcccHHHHHHHHHHHHHHHHHHHTcHHcc############# DISOP:02AL 1-3,198-199| PSIPRED cccEEEEEEEEcccEEEEEEEEEcccEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEHHHHEEEEEEEccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //