[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisD
DDBJ      :hisD         histidinol dehydrogenase
Swiss-Prot:HISX_AGRT5   RecName: Full=Histidinol dehydrogenase;         Short=HDH;         EC=1.1.1.23;

Homologs  Archaea  55/68 : Bacteria  713/915 : Eukaryota  120/199 : Viruses  0/175   --->[See Alignment]
c.82.1
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->429 1kaeA PDBj 3e-67 40.9 %
:RPS:PDB   164->335 2bvcA PDBj 4e-29 9.3 %
:RPS:PDB   317->379 1ao8A PDBj 2e-06 15.9 %
:RPS:SCOP  4->429 1k75A  c.82.1.2 * 1e-47 40.5 %
:HMM:SCOP  1->429 1k75A_ c.82.1.2 * 6.4e-84 30.8 %
:RPS:PFM   29->428 PF00815 * Histidinol_dh e-107 63.1 %
:HMM:PFM   26->429 PF00815 * Histidinol_dh 2.7e-156 50.9 401/413  
:BLT:SWISS 1->432 HISX_AGRT5 0.0 100.0 %
:PROS 230->262|PS00611|HISOL_DEHYDROGENASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86351.1 GT:GENE hisD GT:PRODUCT histidinol dehydrogenase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(527870..529168) GB:FROM 527870 GB:TO 529168 GB:DIRECTION - GB:GENE hisD GB:PRODUCT histidinol dehydrogenase GB:PROTEIN_ID AAK86351.1 GB:DB_XREF GI:15155475 GB:GENE:GENE hisD LENGTH 432 SQ:AASEQ MAIWLERASADFEQKFAAFLTTKREVSEDVNATVRDIINDVRHRGDAALAHYSQKFDGIDFTRVSMRVTADEIDAAFSAVDRAVIEALELAARRIEKHHARQMPKDDIYEDDIGVGLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERIVMVVPANGGAVNPAVLAAARIAGVEEIYRIGGAQAVAALAYGTETIAPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVLVIADKDNDPDWLAADLLAQAEHDRGAQSILITDNADLGKAVGAAVERQLKLLSRSETAAASWADFGAIILVEKLTDAIPLANRIAAEHLELAVDDPDALMAHIRNAGAIFVGRHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPEQLRQLAPAAITLAHSEGLDAHARSVSIRLNPES GT:EXON 1|1-432:0| SW:ID HISX_AGRT5 SW:DE RecName: Full=Histidinol dehydrogenase; Short=HDH; EC=1.1.1.23; SW:GN Name=hisD; OrderedLocusNames=Atu0537; ORFNames=AGR_C_948; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Metal-binding; NAD; Oxidoreductase; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->432|HISX_AGRT5|0.0|100.0|432/432| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 230->262|PS00611|HISOL_DEHYDROGENASE|PDOC00534| BL:PDB:NREP 1 BL:PDB:REP 27->429|1kaeA|3e-67|40.9|391/427| RP:PDB:NREP 2 RP:PDB:REP 164->335|2bvcA|4e-29|9.3|172/475| RP:PDB:REP 317->379|1ao8A|2e-06|15.9|63/162| RP:PFM:NREP 1 RP:PFM:REP 29->428|PF00815|e-107|63.1|398/412|Histidinol_dh| HM:PFM:NREP 1 HM:PFM:REP 26->429|PF00815|2.7e-156|50.9|401/413|Histidinol_dh| GO:PFM:NREP 4 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00815|IPR012131| GO:PFM GO:0004399|"GO:histidinol dehydrogenase activity"|PF00815|IPR012131| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00815|IPR012131| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00815|IPR012131| RP:SCP:NREP 1 RP:SCP:REP 4->429|1k75A|1e-47|40.5|420/431|c.82.1.2| HM:SCP:REP 1->429|1k75A_|6.4e-84|30.8|422/0|c.82.1.2|1/1|ALDH-like| OP:NHOMO 990 OP:NHOMOORG 888 OP:PATTERN ---1--1111111111-1111111111111111111111111111111111111-1-111-1----11 1111111111211111111-11111311111111111122111121111111112111--111111211111111111--11111111111111-----1-111111111---------------111111111111111111111222122211111111111211221111111111111111111111111111111111111111211111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111112111111111--11111111-----111111111111111111111112111111211231-2111123212421111133321223131111111111111111-----------------------------21211111111122121111111112111111112122111111111111111121111111111111111111111-1211111111111-1111111111111111111111111111-1-------11111111111112111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1-11111111111111111121111111111--------111111111121111111111111111111111111111--------------------------------------1--1-111111 ------1-----11111212221232122111111111111111111111122232111111111111-1111111111111111111-11111111111111111-16-------------------------------------------------1----------------111181111121332231121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 92.8 SQ:SECSTR ##########################cHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccc##cccccHHHHHHHHHHccHHHHHHH#HHHHHHHHHHTTccccEEE#EEETTEEEEEEEEEccEEEEEccccccccTHHHHH#HHHHHHHcccEEEEEEcTTTEEccccTTcGGGccHHHHHHHHHHHHHHHHHHHHHcccTTHHHHccTTccccccccEEETcTccEEEccccccTTccccccccHHHHHHHHHHHHHHHHHTTccccccccccGGGccHHHHHTcccccccHHHHHHHHHccHHcccHHHHHHHHHHHHHTHHHHHTcccHHHHHTTEEEEccccccccccccTTccccccHHHHTcHHHHHHHHTcTTccEEEETTHHHHHHHHHHHHTcccccccccEETEEEEcccEEEEEccTT DISOP:02AL 18-29, 429-432| PSIPRED cEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEEEEEEccEEEEcccccccHHHHHHHHHHHHEEEcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccEEEccccHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHEEEEEcccccHHHHcccccccccccccccHHHcccccHHHHHcEEEEEEEcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccc //