[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisE
DDBJ      :hisE         phosphoribosyl-ATP pyrophosphohydrolase
Swiss-Prot:HIS2_AGRT5   RecName: Full=Phosphoribosyl-ATP pyrophosphatase;         Short=PRA-PH;         EC=3.6.1.31;

Homologs  Archaea  3/68 : Bacteria  196/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->92 2a7wA PDBj 2e-13 25.9 %
:RPS:SCOP  5->95 1yvwA1  a.204.1.4 * 8e-19 26.4 %
:HMM:SCOP  5->96 1yvwA1 a.204.1.4 * 3.2e-24 45.7 %
:RPS:PFM   15->92 PF01503 * PRA-PH 9e-09 46.1 %
:HMM:PFM   7->92 PF01503 * PRA-PH 5.4e-15 34.6 81/83  
:BLT:SWISS 1->107 HIS2_AGRT5 1e-47 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85862.2 GT:GENE hisE GT:PRODUCT phosphoribosyl-ATP pyrophosphohydrolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(40779..41102) GB:FROM 40779 GB:TO 41102 GB:DIRECTION - GB:GENE hisE GB:PRODUCT phosphoribosyl-ATP pyrophosphohydrolase GB:PROTEIN_ID AAK85862.2 GB:DB_XREF GI:159139472 GB:GENE:GENE hisE LENGTH 107 SQ:AASEQ MSAFSLSDLERIVAKRAAASPDESWTAKLVAAGQERAAKKLGEEAVEAVIAAIAQDRDGLKNEAADLLYHLLVVLKIADIPLSDVFAELERRTGQTGLAEKAARPTP GT:EXON 1|1-107:0| SW:ID HIS2_AGRT5 SW:DE RecName: Full=Phosphoribosyl-ATP pyrophosphatase; Short=PRA-PH; EC=3.6.1.31; SW:GN Name=hisE; OrderedLocusNames=Atu0038; ORFNames=AGR_C_60; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Histidine biosynthesis; Hydrolase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|HIS2_AGRT5|1e-47|100.0|107/107| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 43->54|eeaveaviaaia| RP:PDB:NREP 1 RP:PDB:REP 6->92|2a7wA|2e-13|25.9|85/88| RP:PFM:NREP 1 RP:PFM:REP 15->92|PF01503|9e-09|46.1|76/85|PRA-PH| HM:PFM:NREP 1 HM:PFM:REP 7->92|PF01503|5.4e-15|34.6|81/83|PRA-PH| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01503|IPR008179| GO:PFM GO:0004636|"GO:phosphoribosyl-ATP diphosphatase activity"|PF01503|IPR008179| RP:SCP:NREP 1 RP:SCP:REP 5->95|1yvwA1|8e-19|26.4|91/92|a.204.1.4| HM:SCP:REP 5->96|1yvwA1|3.2e-24|45.7|92/0|a.204.1.4|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 203 OP:NHOMOORG 202 OP:PATTERN ---1----------1--------------------------------------------1-------- --------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1--------------------------------------1---------------------------------------------------------------------------------------------------------1--------------------1---1-----111111111211111111111111-11111111111-111111111111111--11111111111111111111111111------------------------------11111-1111-------------11--------1---------11-----------11111--1111111111--1---------------111111111-------------111111-1-------1--1-111111----1-1-1-1-------1-1--1-----1-11-------1---1------------------1------------111-1111----------------1---------111111111111--------------1---111111--------1---------------------------------------11111111111111--------------1--------------------------------------------------1-111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 86.9 SQ:SECSTR cccccHHHHHHHHHHGGGccTTTcHHHHHHHHcHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHcH############## DISOP:02AL 1-1,93-108| PSIPRED ccHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHccccc //