[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisF
DDBJ      :hisF         imidazoleglycerol-phosphate synthase cyclase
Swiss-Prot:HIS6_AGRT5   RecName: Full=Imidazole glycerol phosphate synthase subunit hisF;         EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF;         Short=IGPS subunit hisF;

Homologs  Archaea  55/68 : Bacteria  715/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->258 1ka9F PDBj 1e-70 54.6 %
:RPS:PDB   3->258 2a0nA PDBj 7e-39 48.0 %
:RPS:SCOP  3->258 1gpwA  c.1.2.1 * 6e-86 48.0 %
:HMM:SCOP  2->256 1thfD_ c.1.2.1 * 1.5e-82 48.2 %
:RPS:PFM   6->237 PF00977 * His_biosynth 1e-59 57.1 %
:HMM:PFM   6->239 PF00977 * His_biosynth 3.6e-90 52.2 224/228  
:BLT:SWISS 1->258 HIS6_AGRT5 e-140 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85863.1 GT:GENE hisF GT:PRODUCT imidazoleglycerol-phosphate synthase cyclase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(41118..41894) GB:FROM 41118 GB:TO 41894 GB:DIRECTION - GB:GENE hisF GB:PRODUCT imidazoleglycerol-phosphate synthase cyclase GB:PROTEIN_ID AAK85863.1 GB:DB_XREF GI:15154902 GB:GENE:GENE hisF LENGTH 258 SQ:AASEQ MTLKARIIPCLDVKDGRVVKGVNFVDLIDAGDPVEAAKAYDAAGADELCFLDITASSDNRDTIFDVVSRTADHCFMPVTVGGGVRSVADIRKLLLCGADKVSINSAAVKDPDFVAQAADKFGNQCIVVSIDAKRVSKDGEADRWEIFTHGGRQPTGIDAVEFAIKMVERGAGELLVTSMDRDGTKSGYDIGLTRSIADQVRVPVIASGGVGTLDDLVAGVRDGHATAVLAASIFHFGTYSIGEAKSYMAEHGIAMRLD GT:EXON 1|1-258:0| SW:ID HIS6_AGRT5 SW:DE RecName: Full=Imidazole glycerol phosphate synthase subunit hisF; EC=4.1.3.-;AltName: Full=IGP synthase cyclase subunit;AltName: Full=IGP synthase subunit hisF;AltName: Full=ImGP synthase subunit hisF; Short=IGPS subunit hisF; SW:GN Name=hisF; OrderedLocusNames=Atu0039; ORFNames=AGR_C_62; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->258|HIS6_AGRT5|e-140|100.0|258/258| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| SEG 36->45|aakaydaaga| BL:PDB:NREP 1 BL:PDB:REP 2->258|1ka9F|1e-70|54.6|251/251| RP:PDB:NREP 1 RP:PDB:REP 3->258|2a0nA|7e-39|48.0|250/251| RP:PFM:NREP 1 RP:PFM:REP 6->237|PF00977|1e-59|57.1|224/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 6->239|PF00977|3.6e-90|52.2|224/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 3->258|1gpwA|6e-86|48.0|250/253|c.1.2.1| HM:SCP:REP 2->256|1thfD_|1.5e-82|48.2|249/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1674 OP:NHOMOORG 887 OP:PATTERN ---2--1111111111-1111112222222222222223222222222322222-2-122-1----22 1112222222222222222-22222222222222222222222222222222222222--222222221122222222--22122222222222-----2-222222223---------------222222223222222233322222222222222223222222222223122334233122222112222222222222222222222222222222121222222221-22212212222222222-1----22-2---22--22----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--1212222222222222212--22222222-----222222322222222222222222222222222222-2222222322222222222222222332222222222222222-----------------------------2322222222222222222222222222222222222222222222222232224233222222222222222222214231222222222-2223223222222223342222333333-2-------22222222222222222222222222222222222222--222222222211222222222222222-2222222222222222222222223322222222222222222222222222-22222221222222-1-----222222321222222-2221---2222222222222323222222222222222--------222222222222224222222222211112232222222--------------------------------------1--2-222221 ------1-----111111111111211111111111111111111111111111-111111111111111111111111111111-11-12111111111121111-11----------------------------------------------------------------3-1-118111111113111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 100.0 SQ:SECSTR HHcccEEEEEEEEETTEETTccccTTcccTTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEEEEEEGEEEEETTEEEEEETTTTEEEEEEHHHHHHHHHHTTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHTTHccEEEEcHHHHTTcccHHHHHHHHHHTTcccccc DISOP:02AL 258-259| PSIPRED cccccEEEEEEEEEccEEEEccccccEEEcccHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHccccEEEEEccccccccccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEccccHHHcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEHHHHcccccHHHHHHHHHHcccccccc //