[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisI
DDBJ      :hisI         phosphoribosyl c-AMP cyclohydrolase
Swiss-Prot:HIS3_AGRT5   RecName: Full=Phosphoribosyl-AMP cyclohydrolase;         Short=PRA-CH;         EC=3.5.4.19;

Homologs  Archaea  55/68 : Bacteria  702/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
b.168.1
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->143 1zpsB PDBj 7e-30 53.4 %
:RPS:PDB   56->104 3crcB PDBj 8e-05 8.2 %
:RPS:SCOP  24->143 1zpsA1  b.168.1.1 * 3e-41 53.0 %
:HMM:SCOP  15->140 1zpsA1 b.168.1.1 * 1.5e-39 52.4 %
:RPS:PFM   45->120 PF01502 * PRA-CH 3e-24 64.9 %
:HMM:PFM   45->121 PF01502 * PRA-CH 1e-37 70.7 75/75  
:BLT:SWISS 1->150 HIS3_AGRT5 1e-86 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87520.2 GT:GENE hisI GT:PRODUCT phosphoribosyl c-AMP cyclohydrolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1737056..1737508 GB:FROM 1737056 GB:TO 1737508 GB:DIRECTION + GB:GENE hisI GB:PRODUCT phosphoribosyl c-AMP cyclohydrolase GB:PROTEIN_ID AAK87520.2 GB:DB_XREF GI:159140178 GB:GENE:GENE hisI LENGTH 150 SQ:AASEQ MSIPFPSAPADKEALENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAEALSLTLETGIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFYRTVELSNGDAVTKITDDTRHFDPATTYSNT GT:EXON 1|1-150:0| SW:ID HIS3_AGRT5 SW:DE RecName: Full=Phosphoribosyl-AMP cyclohydrolase; Short=PRA-CH; EC=3.5.4.19; SW:GN Name=hisI; OrderedLocusNames=Atu1750; ORFNames=AGR_C_3213; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->150|HIS3_AGRT5|1e-86|100.0|150/150| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 21->143|1zpsB|7e-30|53.4|118/128| RP:PDB:NREP 1 RP:PDB:REP 56->104|3crcB|8e-05|8.2|49/220| RP:PFM:NREP 1 RP:PFM:REP 45->120|PF01502|3e-24|64.9|74/75|PRA-CH| HM:PFM:NREP 1 HM:PFM:REP 45->121|PF01502|1e-37|70.7|75/75|PRA-CH| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01502|IPR002496| GO:PFM GO:0004635|"GO:phosphoribosyl-AMP cyclohydrolase activity"|PF01502|IPR002496| RP:SCP:NREP 1 RP:SCP:REP 24->143|1zpsA1|3e-41|53.0|115/124|b.168.1.1| HM:SCP:REP 15->140|1zpsA1|1.5e-39|52.4|124/0|b.168.1.1|1/1|HisI-like| OP:NHOMO 834 OP:NHOMOORG 810 OP:PATTERN ---1--1111111111-1111111111111111111111111111111111111-1-111-1----11 1111111111111111111-11111111111111111111111111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111221111111111111111111211211111111111111111111111-11-11111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111--1-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111111111111111-1111111111111111111211111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111131111111111111111111-1111111111111-111111111----111111111111111-1-------11111111112111111111111111111111111111--111111111111111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-1-----111111211111111-11-----1111111111111111112122111111111--------111111111111111111111111111111111--1111--------------------------------------1--1-111111 ------------11-11-1----121-11--------111111111-------------------111--11---111111-----------1-------11---1--2------------------------------------------------------------------1111811111-111-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 88.7 SQ:SECSTR #####ccTTccHHHHHHHHHHHHTTccTTcEEEccccTTTHHHHHHHcTTccEEEHHHHHTTcccccccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHcc##cccTTcccccccEEEE###TTEEEEcTTccccccc####### DISOP:02AL 1-15,143-151| PSIPRED cccccccccccHHHccHHHcccccccccccEEEEEEEcccccEEEEEEEcHHHHHHHHHccEEEEEEcccccEEccccccccEEEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccc //