[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hisS-2
DDBJ      :hisS-2       histidyl-tRNA synthetase
Swiss-Prot:HISZ_AGRT5   RecName: Full=ATP phosphoribosyltransferase regulatory subunit;

Homologs  Archaea  8/68 : Bacteria  68/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   296->359 1wu7B PDBj 4e-09 51.7 %
:RPS:PDB   25->110 11asA PDBj 1e-09 7.0 %
:RPS:PDB   312->366 3bjuD PDBj 2e-04 14.8 %
:RPS:SCOP  25->110,282->365 1usyA  d.104.1.1 * 2e-14 23.7 %
:HMM:SCOP  13->370 1kmmA2 d.104.1.1 * 1.6e-41 34.7 %
:HMM:PFM   15->129 PF00587 * tRNA-synt_2b 1.9e-07 24.3 115/173  
:BLT:SWISS 1->375 HISZ_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86487.1 GT:GENE hisS-2 GT:PRODUCT histidyl-tRNA synthetase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 672807..673934 GB:FROM 672807 GB:TO 673934 GB:DIRECTION + GB:GENE hisS-2 GB:PRODUCT histidyl-tRNA synthetase GB:PROTEIN_ID AAK86487.1 GB:DB_XREF GI:15155637 GB:GENE:GENE hisS-2 LENGTH 375 SQ:AASEQ MPLIDMPEFAGELLEEFAARRTSRVNTPVIQPAEPFLDMAGEDLRRRIFMTESETGESLCLRPEFTIPVCLRHIETATGTPKRYSYLGEVFRQRREGASEFYQAGIEDLGDTDIAAADARVVIDATAILQRLLPGRSLAVTLGDQQVFEAVVAALGLPLGWQKRLVQAFGDMAQLDALLESLVHPKPMTGLDARVAGLLATGDEAVLVDYLDTVMQETGYSTNASRSPLEIARRLREKLALAATRLPDESFELLKQFLALQAPLPQASQVLGDFAARAKLKLDGALSAFDKRVAALANAGVDLETVTYGAAFGRPLDYYTGLVFEVVEAGSDSVLAGGGRYDRLLTLLGAQEKIPAVGFSLWLDRIKAVRGSDKP GT:EXON 1|1-375:0| SW:ID HISZ_AGRT5 SW:DE RecName: Full=ATP phosphoribosyltransferase regulatory subunit; SW:GN Name=hisZ; OrderedLocusNames=Atu0678; ORFNames=AGR_C_1214; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->375|HISZ_AGRT5|0.0|100.0|375/375| GO:SWS:NREP 3 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| SEG 8->19|efagelleefaa| SEG 111->128|dtdiaaadarvvidatai| SEG 232->246|arrlreklalaatrl| BL:PDB:NREP 1 BL:PDB:REP 296->359|1wu7B|4e-09|51.7|60/407| RP:PDB:NREP 2 RP:PDB:REP 25->110|11asA|1e-09|7.0|86/327| RP:PDB:REP 312->366|3bjuD|2e-04|14.8|54/499| HM:PFM:NREP 1 HM:PFM:REP 15->129|PF00587|1.9e-07|24.3|115/173|tRNA-synt_2b| RP:SCP:NREP 1 RP:SCP:REP 25->110,282->365|1usyA|2e-14|23.7|152/275|d.104.1.1| HM:SCP:REP 13->370|1kmmA2|1.6e-41|34.7|277/322|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 79 OP:NHOMOORG 79 OP:PATTERN -----1------------11111-------------------1----------1-------------- ----------------------------------------------------------------------------------------------------------------------------------------1111-----1------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------111111111111111111111111-11111111111-111111111111111--11111-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 49.1 SQ:SECSTR ######################EEcccccEEETTccccccTTcccccEEcccccTTccEEEccccTTHHHHHHHHTTccTTcEEEcEEEEEcTTcccccEEEEEEEEEEc################################################################################################################################################################cccHHHHHHcccHHHHHHHHHHcTTHHHHTccTcccEEcTTEETTEEEEEEEEccccHHHHTTcTTcccccHHHHHHHHcHHcccEEEEEEEHHHH######### DISOP:02AL 373-375| PSIPRED cccccHHHHHHHHHHHHHHcccEEccccccccHHHHHHHcccHHHHEEEEEEcccccEEEEcccccHHHHHHHHHHcccccEEEEEEEEEEEccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcHHHcccccccccEEEEEEEcccccEEEEcccHHHHHHHccccccccEEEEEEcHHHHHHHHccccc //