[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : hupA
DDBJ      :hupA         histone-like protein
Swiss-Prot:DBH1_RHIRD   RecName: Full=DNA-binding protein HRL18;

Homologs  Archaea  1/68 : Bacteria  772/915 : Eukaryota  9/199 : Viruses  2/175   --->[See Alignment]
a.55.1
:91 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->89 1hueA PDBj 4e-26 57.3 %
:RPS:PDB   1->90 3c4iA PDBj 1e-26 35.6 %
:RPS:SCOP  1->68 1b8zA  a.55.1.1 * 9e-17 35.8 %
:HMM:SCOP  1->90 1exeA_ a.55.1.1 * 4.1e-30 50.0 %
:RPS:PFM   1->89 PF00216 * Bac_DNA_binding 1e-18 55.1 %
:HMM:PFM   1->90 PF00216 * Bac_DNA_binding 2.1e-37 51.1 90/90  
:BLT:SWISS 1->91 DBH1_RHIRD 3e-46 98.9 %
:PROS 46->65|PS00045|HISTONE_LIKE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87057.1 GT:GENE hupA GT:PRODUCT histone-like protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1251588..1251863 GB:FROM 1251588 GB:TO 1251863 GB:DIRECTION + GB:GENE hupA GB:PRODUCT histone-like protein GB:PROTEIN_ID AAK87057.1 GB:DB_XREF GI:15156311 GB:GENE:GENE hupA LENGTH 91 SQ:AASEQ MNKNELVSAVAEKAGLTKADAASAVDAVFETVQGELKNGGDIRLAGFGSFSVSRREASKGRNPSTGAEVDIPARNVPKFSAGKGLKDAVNS GT:EXON 1|1-91:0| SW:ID DBH1_RHIRD SW:DE RecName: Full=DNA-binding protein HRL18; SW:GN SW:KW Direct protein sequencing; DNA condensation; DNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|DBH1_RHIRD|3e-46|98.9|91/91| GO:SWS:NREP 2 GO:SWS GO:0030261|"GO:chromosome condensation"|DNA condensation| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| PROS 46->65|PS00045|HISTONE_LIKE|PDOC00044| BL:PDB:NREP 1 BL:PDB:REP 1->89|1hueA|4e-26|57.3|89/90| RP:PDB:NREP 1 RP:PDB:REP 1->90|3c4iA|1e-26|35.6|90/99| RP:PFM:NREP 1 RP:PFM:REP 1->89|PF00216|1e-18|55.1|89/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF00216|2.1e-37|51.1|90/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 1->68|1b8zA|9e-17|35.8|67/67|a.55.1.1| HM:SCP:REP 1->90|1exeA_|4.1e-30|50.0|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 2013 OP:NHOMOORG 784 OP:PATTERN ------------------------------1------------------------------------- 342-2-------------------------------1---111151--111-12111-1112111--11111111111----1-12232321-422---12222222-11---------------2232222242211111---2173112211122111111111311411111111111111--1111-311333333333344344221112334111111111111112-1111111111111111111111211211111111111211112111111111111111111111111-111111111111111111111211111111111111211111111-11111111111132111111121-1131644333333213232222222233333333333-22222432433-6457333444333333322235333335555555534334943----------111111111111111--1-234633232223335334333333563233333454454336553234332424333636445433343333334374544322635345515458655492232325411--111111--1-------1211-654541445335445555444454444444441-3434321222244444444444444244-44444444444444444444444444444444444444444444444444451444444444444--6333333333343443333333333333333333333333364555544564555545541111111113644444444445443333433333333321D-----------------1-1112---1--------1----11-121111-1111-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----111--1111--------1------ ---------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 91 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHT PSIPRED ccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEEEEccccccccccccEEEEccccEEEEEccHHHHHHHHc //