[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ilvA.1
DDBJ      :ilvA         threonine dehydratase
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  676/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.79.1d.58.18
:424 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->418 1tdjA PDBj 3e-47 34.5 %
:RPS:PDB   14->359 2c2bC PDBj 1e-52 15.4 %
:RPS:SCOP  15->337 1tdjA1  c.79.1.1 * 1e-64 34.3 %
:RPS:SCOP  341->407 1tdjA3  d.58.18.2 * 4e-19 30.3 %
:HMM:SCOP  12->370 1e5xA_ c.79.1.1 * 1.4e-94 34.2 %
:HMM:SCOP  332->425 1tdjA3 d.58.18.2 * 5.3e-25 40.7 %
:RPS:PFM   36->318 PF00291 * PALP 2e-20 32.1 %
:RPS:PFM   332->418 PF00585 * Thr_dehydrat_C 3e-13 39.5 %
:HMM:PFM   26->319 PF00291 * PALP 5.5e-70 34.9 278/297  
:HMM:PFM   332->421 PF00585 * Thr_dehydrat_C 2.7e-21 39.3 89/91  
:BLT:SWISS 17->424 THD1_BACHD 9e-92 43.7 %
:PROS 49->62|PS00165|DEHYDRATASE_SER_THR
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87007.2 GT:GENE ilvA.1 GT:PRODUCT threonine dehydratase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1198612..1199886 GB:FROM 1198612 GB:TO 1199886 GB:DIRECTION + GB:GENE ilvA GB:PRODUCT threonine dehydratase GB:PROTEIN_ID AAK87007.2 GB:DB_XREF GI:159139959 GB:GENE:GENE ilvA LENGTH 424 SQ:AASEQ MNFNGLTIVDKQLVEAARREVREIFPETPLQLNEHLSRRYGASIWLKREDLSPVRSYKIRGAFNFLRKAVAKAGKDKVFVCASAGNHAQGFAFACRHFGVHGVVFMPVTTPQQKIEKTRIFGGEFIKIRLVGDIFDQCYAAARQHVQDHDGYMVPPFDHEDIIEGQATVAAEIMDQLPEGTKPDIVVMPVGGGGLSAGLTGFLAGTVKKENFVFCEPEGAPSLKKSLERGEPVTLNKVDNFVDGAAVARIGDLNFKALKDFPAEQVMLIPENAICVTIIEMLNLEGVVLEPAGALSIAALERLGRERLEGKTVIAVVSGGNFDFERLPDVKERAMRYTGVKKYFILRLPQRPGALRDFLNLLGPDDDIARFEYLKKSARNFGSILIGIETNAQENFAGLLERFEAAGLGYEDITENDILSNLII GT:EXON 1|1-424:0| BL:SWS:NREP 1 BL:SWS:REP 17->424|THD1_BACHD|9e-92|43.7|403/415| PROS 49->62|PS00165|DEHYDRATASE_SER_THR|PDOC00149| SEG 191->206|gggglsagltgflagt| BL:PDB:NREP 1 BL:PDB:REP 18->418|1tdjA|3e-47|34.5|391/494| RP:PDB:NREP 1 RP:PDB:REP 14->359|2c2bC|1e-52|15.4|337/442| RP:PFM:NREP 2 RP:PFM:REP 36->318|PF00291|2e-20|32.1|271/293|PALP| RP:PFM:REP 332->418|PF00585|3e-13|39.5|86/91|Thr_dehydrat_C| HM:PFM:NREP 2 HM:PFM:REP 26->319|PF00291|5.5e-70|34.9|278/297|PALP| HM:PFM:REP 332->421|PF00585|2.7e-21|39.3|89/91|Thr_dehydrat_C| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| GO:PFM GO:0004794|"GO:L-threonine ammonia-lyase activity"|PF00585|IPR001721| GO:PFM GO:0009097|"GO:isoleucine biosynthetic process"|PF00585|IPR001721| RP:SCP:NREP 2 RP:SCP:REP 15->337|1tdjA1|1e-64|34.3|315/331|c.79.1.1| RP:SCP:REP 341->407|1tdjA3|4e-19|30.3|66/75|d.58.18.2| HM:SCP:REP 12->370|1e5xA_|1.4e-94|34.2|351/477|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| HM:SCP:REP 332->425|1tdjA3|5.3e-25|40.7|91/91|d.58.18.2|1/1|ACT-like| OP:NHOMO 1652 OP:NHOMOORG 894 OP:PATTERN 11--1111111111111211111-31122121---------------1-------1-1--31111-11 2241111111111121111-121112111111222213221111111-111111111111222-233121-1111111-------------1-1---11-1112-12221--------------------------33344---211-11--121--11111111-1212-1111122121124211-12112122222222222222221221222133411--1111112112222222222222222211----11-----------1-1-1-1-1-------11111111111111-------------111111111--21-11111111111-111111111-1-1113122-11-1-3------113-12222-11-111433111122121111-11-113-1131131344--3332447344231322224312223441111111121111-22----------111111111111111-----21221355343333433333233443333232442423113331244442424411211112111111111122111---1---11-----11111111-111111-111111111111-1-------11-1111112211212111111121111111111111--11112------21111222222222222-2222222222222222222222321222222222222222222322222221-42222222222211-----------11332111111-111-111133233212211134434242242341232---------1111111111111111111111-211111-11-11-1---------------------1--------1--------1---11111-31 ----332----12234223233342432222122211322211122332443633331222331111121111211223312222211-23221113331112423--42C3733112-1123-93-4-4B3-32413115-3431112-3--53222689539513212323622233F3335322133223253342 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 412 STR:RPRED 97.2 SQ:SECSTR #####cccccHHHTccGGGccccccccccEEEcHHHHHHHcccEEEEETTccccccTHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHTTccEEEEEETTccccTTHHHHHTTcEEEEEEEEcccHHHHHHHHHHHHHHccEEEccccccHHHHHHHTHHHHHHHHHTTccccccEEEEEccHHHHHHHHHHHHHHHTTcccEEEEEEGGGcHHHHHHHTTccccccccccccTTTcccccTTHHHHHHHHHHTTcEEEEEcHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHTTcTTccEEEEEcccGGGcHHHTccTTcccTTccccTTccccccccHHHHHHHHHHTTccTTEEEEEEEEccccc#cEEEEEEEccTHHHHHHHHHHHTccccEEETTcccHH###### DISOP:02AL 1-1| PSIPRED ccccccccccHHHHHHHHHHHHHHcccccEEEcccccHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHcccEEEEcccccHHHccccccccHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEEEccccEEEEEEEEEEccHHHHHHHHHHHHHcccEEEEEcccHHHHHHcc //