[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ilvA.2
DDBJ      :ilvA         threonine dehydratase
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  683/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:324 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->322 2zpuA PDBj 9e-54 39.0 %
:RPS:PDB   7->320 2d1fA PDBj 9e-47 22.3 %
:RPS:SCOP  8->322 1tdjA1  c.79.1.1 * 4e-55 32.9 %
:HMM:SCOP  4->325 1e5xA_ c.79.1.1 * 4.2e-86 36.3 %
:RPS:PFM   29->307 PF00291 * PALP 4e-19 38.3 %
:HMM:PFM   18->308 PF00291 * PALP 9e-72 40.8 282/297  
:BLT:SWISS 10->312 SRY1_YEAST 1e-53 39.3 %
:PROS 42->55|PS00165|DEHYDRATASE_SER_THR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88450.1 GT:GENE ilvA.2 GT:PRODUCT threonine dehydratase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2730631..2731605) GB:FROM 2730631 GB:TO 2731605 GB:DIRECTION - GB:GENE ilvA GB:PRODUCT threonine dehydratase GB:PROTEIN_ID AAK88450.1 GB:DB_XREF GI:15157951 GB:GENE:GENE ilvA LENGTH 324 SQ:AASEQ MTDISMIEAARERIGNHAVRTPLLTSPFLDEIAGRKLFVKAECLQRTGSFKFRGGWSAVSGLPADVRAKGVIAFSSGNHAQGVALAARLHGIPAVIIMPSDAPKIKIDNTRAYGAEVVLYDRANEDRDAIGNRLSSERGLTLIRPYDEPLVIAGQGTAGLEIAEQGAELGIGAAEVLVPCGGGGLTSGISLALDAKARNYKVRTAEPERFDDVARSLAAGKIERNATTSGSICDAIVTPQPGNITFPIMAGLCGKGIAVSEEEALRAMVLAFNRLKVVIEPGGAVALAAALFHGKELESETVIAVASGGNVDPGIMADALSRFG GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 10->312|SRY1_YEAST|1e-53|39.3|298/326| PROS 42->55|PS00165|DEHYDRATASE_SER_THR|PDOC00149| BL:PDB:NREP 1 BL:PDB:REP 7->322|2zpuA|9e-54|39.0|310/319| RP:PDB:NREP 1 RP:PDB:REP 7->320|2d1fA|9e-47|22.3|310/349| RP:PFM:NREP 1 RP:PFM:REP 29->307|PF00291|4e-19|38.3|269/293|PALP| HM:PFM:NREP 1 HM:PFM:REP 18->308|PF00291|9e-72|40.8|282/297|PALP| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| RP:SCP:NREP 1 RP:SCP:REP 8->322|1tdjA1|4e-55|32.9|310/331|c.79.1.1| HM:SCP:REP 4->325|1e5xA_|4.2e-86|36.3|317/477|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 1766 OP:NHOMOORG 916 OP:PATTERN 11--2111111111111211111131122121-----------1-1-1--111--2-11131112-21 2262211122111121111-121112111111222223321221122-111111121111431-444131-1111111-------------1-1---11-1112111221--------------------------33344---111-1111221--21222212-1332-2211222221125211111113233333333233333321112233133512--1111112112222222222222221111----11-----------1-1-1-2-2-------11111111111111-------------111111111--31-11111111111-111111112-2-1112122-21-1-2------114-12222-11-111433111122121111-11-1-3-11311313451-3332448334232322235313223441111111131111-22----------111111111111111-----21421355344554444444344454444343552323113331253342425411211112111111111122111---1---11-----11111111-111111-111111111111-1-------11-1111112211212111111111211111121112--11112------21112222222222222-2222222222222222222222321222222222222222222422222221-42222222222211-----------11332111111-111-1111333332122111444443422433412221----11--11111111111111122222221321111-11-11-----------------------1--------1-------1----11111-31 ----332-11-12224333333342442222224332211211122332234654331222231111121111211222211111111-24131111121112322-293F3843111-1112193-3-392-21112-2212121111121122222499428513112423512234N3335421133223353345 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 100.0 SQ:SECSTR HHcHHHccccccccccccccccEEEcHHHHHHHccEEEEEEGGGcTTccTTHHHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHTcEEEEEEccccccHHHHHHHHHTTcEEEEccccHHHHHHHHHHHHHHcTTEEEccTTcHHHHHHHTHHHHHHHHHHcccccEcccEEEEccccHHHHHHHHHHHHHTTccccccEEEEEEEGGGcHHHHccccccccccccGGGcccccTTHHHHHHHHHHHTcEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHTcccTTcEEEEEEcccGGcHHHHHcccHHTT PSIPRED cccHHHHHHHHHHHHcccccccEEEcccccHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHc //