[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ilvC
DDBJ      :ilvC         ketol-acid reductoisomerase
Swiss-Prot:ILVC_AGRT5   RecName: Full=Ketol-acid reductoisomerase;         EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase;

Homologs  Archaea  52/68 : Bacteria  733/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->328 1np3A PDBj e-117 60.2 %
:RPS:PDB   5->45 3cmmC PDBj 4e-04 26.8 %
:RPS:PDB   55->283 2b0jA PDBj 2e-31 20.4 %
:RPS:SCOP  7->182 1qmgA2  c.2.1.6 * 2e-21 24.3 %
:RPS:SCOP  184->328 1np3A1  a.100.1.2 * 1e-13 65.5 %
:HMM:SCOP  1->183 1np3A2 c.2.1.6 * 4.2e-70 59.3 %
:HMM:SCOP  184->333 1qmgA1 a.100.1.2 * 2.9e-69 58.4 %
:RPS:PFM   13->178 PF07991 * IlvN 5e-56 60.0 %
:RPS:PFM   184->327 PF01450 * IlvC 4e-45 59.4 %
:HMM:PFM   14->178 PF07991 * IlvN 1.7e-72 57.9 164/165  
:HMM:PFM   184->328 PF01450 * IlvC 2.4e-61 52.1 144/145  
:BLT:SWISS 1->339 ILVC_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87773.1 GT:GENE ilvC GT:PRODUCT ketol-acid reductoisomerase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1979992..1981011) GB:FROM 1979992 GB:TO 1981011 GB:DIRECTION - GB:GENE ilvC GB:PRODUCT ketol-acid reductoisomerase GB:PROTEIN_ID AAK87773.1 GB:DB_XREF GI:15157143 GB:GENE:GENE ilvC LENGTH 339 SQ:AASEQ MRVYYDRDADLNLIKSKNVVIVGYGSQGRAHALNLKDSGAKNVVIALKAGSPTVKKAEADGFKVMTVAEAAKWGDLLMMATPDELQADIYKADIAGNIRDGAAIAFAHGLNVHFGLIEPKASLDVVMIAPKGPGHTVRGEYQKGGGVPCLVAVHHNASGNALELALSYACGVGGGRSGIIETNFKEECETDLFGEQVVLCGGLVELIRAGFETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEWGEYVTGPRIITAETKAEMKRVLHDIQTGKFTSDWMQEYRSGAARFKGIRRMNDTHQIEEVGAKLRGMMPWIGKNKLVDKAVN GT:EXON 1|1-339:0| SW:ID ILVC_AGRT5 SW:DE RecName: Full=Ketol-acid reductoisomerase; EC=1.1.1.86;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; SW:GN Name=ilvC; OrderedLocusNames=Atu2019; ORFNames=AGR_C_3660; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->339|ILVC_AGRT5|0.0|100.0|339/339| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 1->328|1np3A|e-117|60.2|327/327| RP:PDB:NREP 2 RP:PDB:REP 5->45|3cmmC|4e-04|26.8|41/1006| RP:PDB:REP 55->283|2b0jA|2e-31|20.4|211/344| RP:PFM:NREP 2 RP:PFM:REP 13->178|PF07991|5e-56|60.0|165/165|IlvN| RP:PFM:REP 184->327|PF01450|4e-45|59.4|143/145|IlvC| HM:PFM:NREP 2 HM:PFM:REP 14->178|PF07991|1.7e-72|57.9|164/165|IlvN| HM:PFM:REP 184->328|PF01450|2.4e-61|52.1|144/145|IlvC| GO:PFM:NREP 6 GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF07991|IPR013116| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF07991|IPR013116| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07991|IPR013116| GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF01450|IPR000506| GO:PFM GO:0009082|"GO:branched chain family amino acid biosynthetic process"|PF01450|IPR000506| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01450|IPR000506| RP:SCP:NREP 2 RP:SCP:REP 7->182|1qmgA2|2e-21|24.3|173/226|c.2.1.6| RP:SCP:REP 184->328|1np3A1|1e-13|65.5|145/145|a.100.1.2| HM:SCP:REP 1->183|1np3A2|4.2e-70|59.3|182/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 184->333|1qmgA1|2.9e-69|58.4|149/288|a.100.1.2|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 966 OP:NHOMOORG 895 OP:PATTERN ---1--1122222231-11111111--11111111111111111121111111111-----1--1-11 1111111111111111111-111111111111111111111111111-111111111111112111112112111222-11-111111111111---11--111111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222222122222211111122211111--1111111111111111111111111111---------------------1-111-------11111111111111-------------111111111-11-11-------1-111221---1-1--111111111111-111111--1-11111111111111111111111111111111111-11111111111-111111111111111121111111111111111111111111111---------------------------11111111111111111122211111222212111111111111111111111111111111111111111111111-1111111111111-1111111111111-1121111111111111111111111111111111111-1111111111111111111111-1-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111111111-11111111111111111111111111111111111111-1-1111-111111111111111111111111111111111111111--------------------------------------1--1-111121 --------------1111-11111111-1111111111-1111-1111111111111-1111111111-11111111-1111111111-24211211111111212--1----------------------------------------------------------------1-1111B1111122231111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 99.7 SQ:SECSTR TTcccGGGccccHHccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEcccHHHHHccGGGGTcEEEccHHHHTTccEEEEccTTcTTHHHHHHHHGGGccTTcEEEEcccHHHHHHHHHHccHHHHHHHHHHTTcTTcEEEEccccccTTTcccEEEEEccccHHHHHHHHcTTTcHHHHHHHccEEEEEHHHHHHHHcTTHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcGGGHHHHccGGGGGGTGGGGcGEEcGGGTTHHHHHHHHHHccccccHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHcccccEcHHHHHHHHHH# DISOP:02AL 335-339| PSIPRED cEEcccccccHHHHcccEEEEEEEcccHHHHHHHHHHcccEEEEEEEccccccHHHHHHcccccccHHHHHHHccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEcccEEEEccEEEccccEEEEEccccccHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHccccccc //