[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ilvI
DDBJ      :ilvI         acetolactate synthase III, large subunit
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  765/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.31.1c.36.1c.92.2
:597 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->575 1n0hA PDBj e-143 46.8 %
:RPS:PDB   14->555 1bfdA PDBj e-129 22.0 %
:RPS:SCOP  5->535 1fp4B  c.92.2.3 * 6e-87 9.4 %
:HMM:SCOP  2->196 1ybhA2 c.36.1.5 * 1.6e-63 42.7 %
:HMM:SCOP  195->373 1jscA1 c.31.1.3 * 9.7e-67 49.4 %
:HMM:SCOP  380->585 2djiA3 c.36.1.9 * 1.9e-65 42.9 %
:RPS:PFM   13->175 PF02776 * TPP_enzyme_N 2e-49 52.1 %
:RPS:PFM   207->339 PF00205 * TPP_enzyme_M 2e-31 48.9 %
:RPS:PFM   422->552 PF02775 * TPP_enzyme_C 6e-31 43.5 %
:HMM:PFM   13->177 PF02776 * TPP_enzyme_N 1.3e-61 51.5 165/172  
:HMM:PFM   406->553 PF02775 * TPP_enzyme_C 2.9e-50 39.5 147/150  
:HMM:PFM   204->340 PF00205 * TPP_enzyme_M 2e-41 44.4 135/137  
:BLT:SWISS 13->576 ILVI_SALTY e-160 50.8 %
:PROS 442->461|PS00187|TPP_ENZYMES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87790.2 GT:GENE ilvI GT:PRODUCT acetolactate synthase III, large subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1994007..1995800) GB:FROM 1994007 GB:TO 1995800 GB:DIRECTION - GB:GENE ilvI GB:PRODUCT acetolactate synthase III, large subunit GB:PROTEIN_ID AAK87790.2 GB:DB_XREF GI:159140295 GB:GENE:GENE ilvI LENGTH 597 SQ:AASEQ MTDKDNTENSNRMTGAEIVLQALKDNGVEHIFGYPGGAVLPIYDEIFQQEDIQHILVRHEQGAGHAAEGYARSTGKVGVMLVTSGPGATNAVTPLQDALMDSIPLVCLSGQVPTSLIGSDAFQECDTVGITRPCTKHNWLVKDVNELAGIIHEAFRIAQTGRPGPVVVDIPKDIQFATGTYTPPSAAIQQKSYKPKVQGDLNAIHAAIELMSKAKKPVFYTGGGVINSGPEATRLLRELVELTNFPITSTLMGLGAYPASGKNWLGMLGMHGSYEANMTMHDCDVMVCIGARFDDRITGRINAFSPNSKKIHIDIDPSSINKTVRVDVPVIGDVGHVLEDMVRLWRALPKKPEKAQTADWWSQIERWRARNSFAYKNSKDVIMPQYALQRLYEASKGRDTYITTEVGQHQMWAAQFFGFEEPNHWMTSGGLGTMGYGLPAAIGVQVAHPEALVIDIAGDASIQMCIQEMSCAIQYGLPVKIFILNNQYMGMVRQWQQLLHGNRLSNSYTEAMPDFVKLAEAYGAVGMYCDDPKELDDKIAEMIAVNKPVIFDCRVANLANCFPMIPSGKAHNEMLLPDEATDEAVANAIDAKGRQLV GT:EXON 1|1-597:0| BL:SWS:NREP 1 BL:SWS:REP 13->576|ILVI_SALTY|e-160|50.8|559/574| PROS 442->461|PS00187|TPP_ENZYMES|PDOC00166| BL:PDB:NREP 1 BL:PDB:REP 13->575|1n0hA|e-143|46.8|555/599| RP:PDB:NREP 1 RP:PDB:REP 14->555|1bfdA|e-129|22.0|518/523| RP:PFM:NREP 3 RP:PFM:REP 13->175|PF02776|2e-49|52.1|163/170|TPP_enzyme_N| RP:PFM:REP 207->339|PF00205|2e-31|48.9|131/138|TPP_enzyme_M| RP:PFM:REP 422->552|PF02775|6e-31|43.5|131/139|TPP_enzyme_C| HM:PFM:NREP 3 HM:PFM:REP 13->177|PF02776|1.3e-61|51.5|165/172|TPP_enzyme_N| HM:PFM:REP 406->553|PF02775|2.9e-50|39.5|147/150|TPP_enzyme_C| HM:PFM:REP 204->340|PF00205|2e-41|44.4|135/137|TPP_enzyme_M| GO:PFM:NREP 5 GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02776|IPR012001| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00205|IPR012000| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF00205|IPR012000| GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 5->535|1fp4B|6e-87|9.4|502/522|c.92.2.3| HM:SCP:REP 2->196|1ybhA2|1.6e-63|42.7|192/0|c.36.1.5|1/2|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 195->373|1jscA1|9.7e-67|49.4|172/0|c.31.1.3|1/1|DHS-like NAD/FAD-binding domain| HM:SCP:REP 380->585|2djiA3|1.9e-65|42.9|203/0|c.36.1.9|2/2|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 3291 OP:NHOMOORG 1000 OP:PATTERN 11-1--5665566674-31221143--21122243222222221312213443111-----2421-11 4361942222223256844-44336E444445455555EE2225223-232196754311635245B97621222111-211811111223112--111-1111142211---------------21111111111222231111934523332211113111222333821111111211111211111-134555554571465536334434545235242-4444432533333333333333334434122145112-27622553331344231112---22222222222222-------------221222111122135-------5-42133111-112--2122165222121221112--1-112222-11-134DAB2149447633333332316-66955A49872-644346A775896414168942367675555555542212333-----------------------------3335226DA88889A988666699DE999958A6I889823654333228355B63333111311111111112522-A22212333333512214112433323353521111111111-1-------1111211322231312222443522333322423233-1-311111111155553655666576766-6646767656666665664777663357566556667667664965666651-65555554555511---1---113232762222222-22213223222221312442A88949464588632332----1---313253333322222332222222211111111331132------------------------111--1-------11--1-111122 ----22---1----25341344497883322322232212133234331322581123112131211511431323322531111133-11132122122112622-26-4232222--1-12124252AK2-424121221251121122-1421123474163211122235111118121336126243223111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 586 STR:RPRED 98.2 SQ:SECSTR #########cEcEcHHHHHHHHHHHTTccEEEEcccGGGHHHHTTcHHcTTcEEEEcccHHHHHHHHHHHHHHHTccEEEEEEHHHHHHHTHHHHHHHHHHTccEEEEEEEccHHHHTTTcTccTTGGGTTTTcccEEEccccGGGHHHHHHHHHHHHHccccccEEEEEEGGGTTccccGGGGGccGTTccccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHHHTcHHHHHHHHHHHTccEEccccccccccTTcTTEEEEcccGcHHHHHHHHTTccEEEEEcccTTcccccccccccTTcEEEEEEccHHHHHHcccccEEEEccHHHHHHHHHHHccTTccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccTTcEEEEEcGGGHHHHHHHcccccTTcEEEcTTccccccHHHHHHHHHHHcTTccEEEEEEHHHHTTTGGGHHHHHHHTcccEEEEEEccccHHHHHHHHHTTccccccccccccccHHHHHHHTTcEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccccTTTTcTTccGGGccccccGcHHHHHHHHHHHHHH## DISOP:02AL 1-14,582-587| PSIPRED ccccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEccccHHHccccccccccHHHHHHHHcEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHcccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcHHHccccHHHHHHHHHHHHHHcccEEEcHHHccccccccccccccccccccHHHHHHHHHccEEEEEccccccccccccccccccccEEEEEccHHHcccccccccEEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHccccEEEEEEccHHHHHcHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHcccccccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccHHHHHcccHHHcccc //