[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : irr
DDBJ      :irr          transcriptional regulator, Fur family
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  220/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->138 1mzbA PDBj 6e-12 34.4 %
:RPS:PDB   12->96 2co5B PDBj 9e-06 13.6 %
:RPS:SCOP  7->138 1mzbA  a.4.5.42 * 1e-15 29.0 %
:HMM:SCOP  7->138 1mzbA_ a.4.5.42 * 1.4e-28 29.5 %
:RPS:PFM   15->97 PF01475 * FUR 2e-12 40.2 %
:HMM:PFM   16->130 PF01475 * FUR 4.3e-23 27.2 114/120  
:BLT:SWISS 11->138 FUR_PSEAE 2e-12 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85974.2 GT:GENE irr GT:PRODUCT transcriptional regulator, Fur family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 160406..160825 GB:FROM 160406 GB:TO 160825 GB:DIRECTION + GB:GENE irr GB:PRODUCT transcriptional regulator, Fur family GB:PROTEIN_ID AAK85974.2 GB:DB_XREF GI:159139519 GB:GENE:GENE irr LENGTH 139 SQ:AASEQ MAFDATLDIGTRLRRSGLRPTRQRVALGDLLFAKGDRHLTVEELHDEAVTAGVPVSLATVYNTLHQFTEAGLIRVLAVEGARTYFDTNVSDHHHFFVEGENEVLDIPINNLQIDNLPEAPEGMEIAHVDVVIRLRRKRG GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 11->138|FUR_PSEAE|2e-12|34.1|126/134| BL:PDB:NREP 1 BL:PDB:REP 11->138|1mzbA|6e-12|34.4|125/133| RP:PDB:NREP 1 RP:PDB:REP 12->96|2co5B|9e-06|13.6|81/94| RP:PFM:NREP 1 RP:PFM:REP 15->97|PF01475|2e-12|40.2|82/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 16->130|PF01475|4.3e-23|27.2|114/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 7->138|1mzbA|1e-15|29.0|131/133|a.4.5.42| HM:SCP:REP 7->138|1mzbA_|1.4e-28|29.5|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 259 OP:NHOMOORG 228 OP:PATTERN --------1111111--1-------------------------------------------------- ---------------------------------1111----------------------------------------------1-----1----------------1---------------------------------------2------------------------------------11------1------------------------------1----------1--------------1-------------------------------------------------------------------------------------------------------------1---------------------11111142221112111322222222221-11111111111-111111121111211--11-1111111-------------211-----------------------------1----------------------------------------11---------------1-1--------------1--------------------------------1-----------------------1-221121-1---1------111----1-1--------112------1111-111111111111-11111111111111111111111----111111111111111111111111-----------------1---------111-1---------------111111----111111111111111111-----------1---1-11------1111111111--------112222------------------------------------------1----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 94.2 SQ:SECSTR #######cHHHccTTccHHHHHHHHHHHHHHHHTTTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEcHHHHHHHHHETccEEEccHHHHHHHHHHHHTHHTTccccccccEEEEcccc# DISOP:02AL 1-5,138-140| PSIPRED ccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccccccEEEcccccEEEEccccccHHHHHHHHcccEEEEEEEEEEEEEccc //