[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : kamA
DDBJ      :kamA         L-lysine 2,3-aminomutase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  379/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.102.1c.1.28
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->340 2a5hB PDBj 3e-63 41.8 %
:RPS:PDB   45->360 2a5hB PDBj 1e-31 37.1 %
:RPS:SCOP  58->163 1fjrA  b.102.1.1 * 3e-17 10.4 %
:HMM:SCOP  92->327 1tv8A_ c.1.28.3 * 1.2e-32 25.4 %
:RPS:PFM   162->254 PF00710 * Asparaginase 8e-04 32.9 %
:RPS:PFM   302->327 PF12544 * LAM_C 3e-05 65.4 %
:HMM:PFM   110->259 PF04055 * Radical_SAM 4.3e-14 25.9 143/166  
:HMM:PFM   303->331 PF12544 * LAM_C 4.8e-08 51.7 29/127  
:BLT:SWISS 45->333 KAMA_CLOSU 1e-67 42.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88280.1 GT:GENE kamA GT:PRODUCT L-lysine 2,3-aminomutase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2528949..2530040 GB:FROM 2528949 GB:TO 2530040 GB:DIRECTION + GB:GENE kamA GB:PRODUCT L-lysine 2,3-aminomutase GB:PROTEIN_ID AAK88280.1 GB:DB_XREF GI:15157746 GB:GENE:GENE kamA LENGTH 363 SQ:AASEQ MGARRGIWTMTRFETIKTPEALLEAGLIEAEALEGLRAVTQRYALAITPAVTGLMDSHDPQDPIARQFVPDLAELVHLPEERDDPIGDDAHSPVHGIVHRYPDRVLLKAVHVCPVYCRFCFRREMVGPQGNGMMSPEELDAAFAYIKENPAIWEVILTGGDPLVLSPRRLSDLMKRLRDIPHVKIVRFHTRVPVVDPDRIDAPLIEALKASGKTTYVALHANHARELGDAARNACARLIDAGIAMVSQTVLLKGINDDPAVLADLMRSFVENRIKPYYLHHPDLAPGTSHFRLTIEEGQRIVSALRGHVSGLCQPTYVLDIPGGHGKAMIGRNAAEKTRDGCYSVSDFNGNDHIYPPATSGSY GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 45->333|KAMA_CLOSU|1e-67|42.5|287/416| SEG 20->38|ealleaglieaealeglra| BL:PDB:NREP 1 BL:PDB:REP 46->340|2a5hB|3e-63|41.8|287/401| RP:PDB:NREP 1 RP:PDB:REP 45->360|2a5hB|1e-31|37.1|307/401| RP:PFM:NREP 2 RP:PFM:REP 162->254|PF00710|8e-04|32.9|79/315|Asparaginase| RP:PFM:REP 302->327|PF12544|3e-05|65.4|26/71|LAM_C| HM:PFM:NREP 2 HM:PFM:REP 110->259|PF04055|4.3e-14|25.9|143/166|Radical_SAM| HM:PFM:REP 303->331|PF12544|4.8e-08|51.7|29/127|LAM_C| GO:PFM:NREP 1 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00710|IPR006034| RP:SCP:NREP 1 RP:SCP:REP 58->163|1fjrA|3e-17|10.4|106/188|b.102.1.1| HM:SCP:REP 92->327|1tv8A_|1.2e-32|25.4|224/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 498 OP:NHOMOORG 418 OP:PATTERN ---1-------------------------------11113212--22-12111------1------11 ----1---------------------------------2---------------------121-31----1----------1-21211------11------------1---------------12--1-311-12-----222--1-----------------------1------------111-------1111111111111111-211111111--1---------21------------------------------------------------------------------------------------------121-------------1------11---1---2113211-311--21-1---11111-----1121311112111------------11111111-2-11111111111111111---11111---1111111111111111-----------------------------------------111--1----------------------------------1------------------1--1--12522133--2----11111114222223222-----------------------1------12112111-----------------1-1-1121211----11111111111111111-11-111111111111111111-112111111111111111111111111111-111111111111--11111111111121111111111111-111111111111111----------------1-11111111111111111111111111111111111111111-222222--------11--------------------------122221111112- ---------------1111----1-1---------------------1---------11111------------------------------1---------------2-2-----------------------------------------------------------------------------11--11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 319 STR:RPRED 87.9 SQ:SECSTR #########################################EEEccccHHHHTTccTTcTTcHHHHHHcccGGGGcccTTccccTTcTTTccccTTHcEEcccccEEEEEEEcccccTTcTTTTTTTcccccccccHHHHHHHHHHHTcTTccEEEEEEccTTcccHHHHHHHHHHHHTcTTccEEEEEccHHHHcGGGccHHHHHHHTTccEEEEEEEccccGGGccHHHHHHHHHHHHTTccEEEEEEEcTTTTccHHHHHHHHHHHHHTTEEEEEEEEccccTTcGGGcccHHHHHHHHHTTTTTccGGGccEEEEEETTTTEEHEEccccEEEEcccEEEEEcTTccEEEEEccTT### DISOP:02AL 1-2, 127-138, 359-363| PSIPRED cccccHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHccccccHHHHHHHHcccHHHHccccccccccccHHHcccccccEEEcccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccEEEEcccccHHHHHHHHHcccEEEEEEccccHHHccHHHHHHHHHHHHcccEEEEccEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccEEEEcccEEEEEccccEEEEccccccccc //