[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : kdgA.1
DDBJ      :kdgA         keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  463/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->207 2v81A PDBj 1e-34 41.1 %
:RPS:PDB   13->129 2c92E PDBj 1e-07 13.6 %
:RPS:SCOP  11->197 1euaA  c.1.10.1 * 2e-32 25.8 %
:HMM:SCOP  8->209 1euaA_ c.1.10.1 * 2.2e-50 40.5 %
:RPS:PFM   11->182 PF01081 * Aldolase 5e-25 44.7 %
:HMM:PFM   11->179 PF01081 * Aldolase 1.3e-28 28.9 166/196  
:BLT:SWISS 9->207 DGOA_ECOLI 3e-36 40.2 %
:PROS 124->137|PS00160|ALDOLASE_KDPG_KHG_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86513.1 GT:GENE kdgA.1 GT:PRODUCT keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(703594..704223) GB:FROM 703594 GB:TO 704223 GB:DIRECTION - GB:GENE kdgA GB:PRODUCT keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase GB:PROTEIN_ID AAK86513.1 GB:DB_XREF GI:15155669 GB:GENE:GENE kdgA LENGTH 209 SQ:AASEQ MRIPFPSIKYPLIAILRGLKPEETEGVVGALIETGFRAIEIPLNSPDPFRSIEIAARMAPADCLIGAGTVLSVEDVASLDAAGGKLMVSPNADAEVITAAREKGMVTMPGVLTPTEALVAAKAGATGLKFFPASIIGPSGINAIRTILPKELIIAAVGGVSDKNFSDYTSAGIRAFGLGTSLYKPGMTAAEVRERATVTLAAYDAAIGG GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 9->207|DGOA_ECOLI|3e-36|40.2|199/205| PROS 124->137|PS00160|ALDOLASE_KDPG_KHG_2|PDOC00144| BL:PDB:NREP 1 BL:PDB:REP 9->207|2v81A|1e-34|41.1|197/203| RP:PDB:NREP 1 RP:PDB:REP 13->129|2c92E|1e-07|13.6|110/146| RP:PFM:NREP 1 RP:PFM:REP 11->182|PF01081|5e-25|44.7|170/194|Aldolase| HM:PFM:NREP 1 HM:PFM:REP 11->179|PF01081|1.3e-28|28.9|166/196|Aldolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01081|IPR000887| GO:PFM GO:0008152|"GO:metabolic process"|PF01081|IPR000887| RP:SCP:NREP 1 RP:SCP:REP 11->197|1euaA|2e-32|25.8|186/213|c.1.10.1| HM:SCP:REP 8->209|1euaA_|2.2e-50|40.5|200/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 716 OP:NHOMOORG 482 OP:PATTERN ------------------------1--1112------------------------------------- 1-1-2-----1--------------3------------341--2111-1---121--1-----111413---------1---1----------------1-1---1-2-1-----------------------------------1111111-1111-1---111111111-11---------22-1111-1-1-------1-------212211----13-2-----1---2------------------113-1-22-----1---23------1112121222---111111211111111111211111-22---222211-231111111-1-2---11111--1--1------------124-1------1112-11-121211--------22222222122-1121121222--2221111111111-2112232123212--------1111------------------------------------221----12222222222222222222222221111--2221-2---1242211--1111-1111111-----------------------------------2-----------1-1-1111111-------1142111-3211211111111111111111-------------22111212112233222-12224232221323323333232111221222122212-111231111111--111111111111----1111111111-123111312-111--1111111111---4122221-11-1111-222----------224411111132351122222122----------------------11----1------1-------------------111-1-1- ------1-----------------------------------------------------------------------------------------------------4------------------------------------------------------2--------------11111--2--1--111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 95.2 SQ:SECSTR ########cccEEEEEEEcccHHHHHHHHHHHHTTccccEEEEEccGGGHHHHHHHHHTcccEEEEEEEEEHHHHTTcccccTHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEccHHHHHTcTcTTccEccccccccHHHHHHHHHTTcccTTEEEccccTTTHHHHHHTTccEEEEcHHHHTTccTTTccccHHHHHHHHHHHHH## PSIPRED ccccccccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEcccccHHHHHHHHHcccEEEcccccHHHHHHHHHccccEEEEccHHHccHHHHHHHHccccccccEEEEccccHHHHHHHHHccccEEEEcHHHccHHHHHHHHHHHHHHHHHHHHHHHcc //