[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : kdgR.1
DDBJ      :kdgR         transcriptional regulator, IclR family
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  430/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->269 1mkmB PDBj 2e-29 28.1 %
:RPS:PDB   38->121 3boqA PDBj 1e-04 17.7 %
:RPS:PDB   101->272 3d3oA PDBj 1e-34 14.7 %
:RPS:SCOP  28->96 1mkmA1  a.4.5.33 * 3e-11 18.8 %
:RPS:SCOP  100->269 1td5A  d.110.2.2 * 2e-44 30.0 %
:HMM:SCOP  26->99 1mkmA1 a.4.5.33 * 7.5e-14 40.5 %
:HMM:SCOP  96->269 1td5A_ d.110.2.2 * 7.7e-50 44.8 %
:RPS:PFM   29->79 PF09339 * HTH_IclR 4e-05 39.2 %
:RPS:PFM   148->267 PF01614 * IclR 2e-13 41.7 %
:HMM:PFM   142->267 PF01614 * IclR 3.6e-38 39.7 126/129  
:HMM:PFM   29->76 PF09339 * HTH_IclR 1.9e-13 31.2 48/52  
:HMM:PFM   68->137 PF10026 * DUF2268 0.001 19.1 68/195  
:BLT:SWISS 21->269 KDGR_ECOLI 1e-33 29.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86516.2 GT:GENE kdgR.1 GT:PRODUCT transcriptional regulator, IclR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 706036..706875 GB:FROM 706036 GB:TO 706875 GB:DIRECTION + GB:GENE kdgR GB:PRODUCT transcriptional regulator, IclR family GB:PROTEIN_ID AAK86516.2 GB:DB_XREF GI:159139740 GB:GENE:GENE kdgR LENGTH 279 SQ:AASEQ MPDDKKANGGKPDAVPPSHQKTENATGTLGKVVSLLELIALAEKPMRFTDVVEASGQPRGTVHRQLAHLVAEGLVDHAADQTYAVGLRLLQLAAKAWSGNDLRNVAAPHLSALQEATQESVHLAVLNGGQVTYLDKMEGRHTLRMHSQVGKTSPAYCTGVGKAALSLLPVDELAELAAGMEFHRFTEATLITPEALMADVAAICDNGYGFDLQEHEIGIHCVAAPVRARGRNFVAAISVTGPAYRVDAEQLRNWAPLVRETADKISAELACRLSPVADD GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 21->269|KDGR_ECOLI|1e-33|29.8|248/263| BL:PDB:NREP 1 BL:PDB:REP 28->269|1mkmB|2e-29|28.1|242/247| RP:PDB:NREP 2 RP:PDB:REP 38->121|3boqA|1e-04|17.7|79/131| RP:PDB:REP 101->272|3d3oA|1e-34|14.7|163/167| RP:PFM:NREP 2 RP:PFM:REP 29->79|PF09339|4e-05|39.2|51/52|HTH_IclR| RP:PFM:REP 148->267|PF01614|2e-13|41.7|120/127|IclR| HM:PFM:NREP 3 HM:PFM:REP 142->267|PF01614|3.6e-38|39.7|126/129|IclR| HM:PFM:REP 29->76|PF09339|1.9e-13|31.2|48/52|HTH_IclR| HM:PFM:REP 68->137|PF10026|0.001|19.1|68/195|DUF2268| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF09339|IPR005471| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF09339|IPR005471| RP:SCP:NREP 2 RP:SCP:REP 28->96|1mkmA1|3e-11|18.8|69/75|a.4.5.33| RP:SCP:REP 100->269|1td5A|2e-44|30.0|170/179|d.110.2.2| HM:SCP:REP 26->99|1mkmA1|7.5e-14|40.5|74/0|a.4.5.33|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 96->269|1td5A_|7.7e-50|44.8|174/0|d.110.2.2|1/1|GAF domain-like| OP:NHOMO 1685 OP:NHOMOORG 439 OP:PATTERN ------------------------B1142-53------------------------------------ --418114556-1143322-27--2G22222165679BVV12134741-112GFJ512--116168LAD821111233----61-111-----1------------------------------------------22211----3-------------------------------------3411311-31122222233232222253331123113333--------62--------------------1-1-11----------1-----------------------------------------------------13--2-----------2--1--------1----11-11-1325-1-2---------------2-634--84322133233332324-122--411B3--5551345445769211-349111244411111111311-------------------------------------8--2GE99799C9966664AAGE777736B5MGJK8-1443424229594F611111---1----------211-1----11-------252254411-----------1---------------------11--2---3-2----------1--------------1-1------42542316446666645-4554656454464665666666341216265646666656555743444431-212222222222----------------261111-2--1-1111155535152315-32221445323422533-------------2-----12123--11111111------------------------------------------------------112111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 87.8 SQ:SECSTR ###########################HHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEETTEEEEEEEEccccTccHcHHHHHHHHHHHHHHHHccEEEEEEEETTEEEEEEEEcccccccccccTTccccGGcHHHHHTTcHHHHHHHHHHHHHHcccHHHHGGGTccccHHHHHHHHHHHHcEEEEEccccTTEEEEEEEEEEETTEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHTTccccc####### DISOP:02AL 1-29,274-280| PSIPRED ccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEEccccEEEEEcccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccEEEccccccccEEEEEEEEcccccEEEEEEEEEEHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccc //