[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : kka
DDBJ      :kka          aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   96->229 3hamA PDBj 1e-06 29.2 %
:RPS:PDB   8->290 2ckpA PDBj 2e-07 15.7 %
:RPS:SCOP  96->262 1j7iA  d.144.1.6 * 6e-18 22.2 %
:HMM:SCOP  14->267 1nd4A_ d.144.1.6 * 2.9e-50 34.6 %
:RPS:PFM   189->243 PF01636 * APH 4e-07 41.8 %
:HMM:PFM   34->257 PF01636 * APH 4.2e-38 27.5 218/238  
:BLT:SWISS 107->250 KKA1_ECOLX 2e-06 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87831.1 GT:GENE kka GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2039845..2040738) GB:FROM 2039845 GB:TO 2040738 GB:DIRECTION - GB:GENE kka GB:PRODUCT aminoglycoside phosphotransferase GB:PROTEIN_ID AAK87831.1 GB:DB_XREF GI:15157211 GB:GENE:GENE kka LENGTH 297 SQ:AASEQ MDDRIVVTTQQVRALIASQFPQWAALDVQPVDLSGWDNRSFRLGEDMLVRMPSAERYVAQVEKEHRWLPELGPLLPVPIPAPLALGQPGEQYPFCWSVYRWLKGEPLARYLDSIELSAIAIDVAAFLKALHGIDASAGPPAGAHNFHRGGSLAVYDGEARASAARLANEVDQALAMEIWQLALSSHWQGKGVWVHGDIAEGNLLVQDGRLSAVIDFGSSGVGDPSSDLILAWNVLDAHSRAVFRQALGLDEATWQRGRGWALWKALIVLDAERGRNEKMAEWSRRTLREIFADHLEN GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 107->250|KKA1_ECOLX|2e-06|30.4|138/271| SEG 71->86|lgpllpvpipaplalg| BL:PDB:NREP 1 BL:PDB:REP 96->229|3hamA|1e-06|29.2|130/299| RP:PDB:NREP 1 RP:PDB:REP 8->290|2ckpA|2e-07|15.7|254/316| RP:PFM:NREP 1 RP:PFM:REP 189->243|PF01636|4e-07|41.8|55/221|APH| HM:PFM:NREP 1 HM:PFM:REP 34->257|PF01636|4.2e-38|27.5|218/238|APH| RP:SCP:NREP 1 RP:SCP:REP 96->262|1j7iA|6e-18|22.2|158/260|d.144.1.6| HM:SCP:REP 14->267|1nd4A_|2.9e-50|34.6|246/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 79 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ----2---------1--12-1---1-11111------1-1---222-1------1--3---1--1-1312---------------------------------------------------------------------1----1-------------------------------------------------111111---1111111-----111-------------12-------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------1---112--1---11---1--------------------------------------1-1---11----1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 89.9 SQ:SECSTR #######TTTTTHHHHHHHccTHHHccGGGccccccccEEEEEccEEEEEEccccHHHHHHHHHHHTTc################cccEEEEETTEEEEEccccccccGTHGGTTcHHHHHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHHHHHccHHHHHHHHHTTcHHHHHHHHHHHHTccccEEEEcccccGGGccccccEEcEccccTTcEEEEHHHHHHHHHHTTcEEcccccTTccGGcccHHHHHHHHHHHHHHHcGGGGGccHHHHHHHHHHHHHHH####### DISOP:02AL 1-2, 296-297| PSIPRED ccccccccHHHHHHHHHHHcccccccccEEEEcccccccEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccHHHcccccccHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEEEcccccccEEEEccEEEEEEEccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc //