[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : leuB
DDBJ      :leuB         3-isopropylmalate dehydrogenase
Swiss-Prot:LEU3_AGRT5   RecName: Full=3-isopropylmalate dehydrogenase;         EC=1.1.1.85;AltName: Full=Beta-IPM dehydrogenase;         Short=IMDH;AltName: Full=3-IPM-DH;

Homologs  Archaea  60/68 : Bacteria  772/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.77.1
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->362 1a05A PDBj 4e-96 50.7 %
:RPS:PDB   8->363 1dr8A PDBj e-107 49.4 %
:RPS:SCOP  8->364 1ai2A  c.77.1.1 * 8e-91 25.4 %
:HMM:SCOP  3->369 1a05A_ c.77.1.1 * 1.3e-114 44.5 %
:RPS:PFM   8->361 PF00180 * Iso_dh 2e-62 46.2 %
:HMM:PFM   7->361 PF00180 * Iso_dh 8.3e-137 53.2 344/347  
:BLT:SWISS 1->370 LEU3_AGRT5 0.0 100.0 %
:PROS 246->265|PS00470|IDH_IMDH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88504.1 GT:GENE leuB GT:PRODUCT 3-isopropylmalate dehydrogenase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2792472..2793584 GB:FROM 2792472 GB:TO 2793584 GB:DIRECTION + GB:GENE leuB GB:PRODUCT 3-isopropylmalate dehydrogenase GB:PROTEIN_ID AAK88504.1 GB:DB_XREF GI:15158015 GB:GENE:GENE leuB LENGTH 370 SQ:AASEQ MTVRSLFLLPGDGIGPEAMTEVRKLIEYMNSAHNAGFTVSEGLVGGSAYDAHGVAISDADMEKALAADAILFGAVGGPKWDGVPYEHRPEAGLLRLRKDLELFANLRPAICYPALAAASSLKPELVEGLDILIVRELTGGVYFGEPKQIIDLGNGQKRGIDTQIYDTFEIERIASVAFELARSRDNRVCSMEKRNVMKSGVLWNQVVTETHAAKYKDVQLEHMLADAGGMQLVRKPKQFDVIVTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKAMYEPVHGSAPDIAGKSIANPIAMIASFAMCLRYSFNMVDEATKLEAAIANVLDKGIRTADIMADGCRQVGTSDMGDAVLAEFKALSA GT:EXON 1|1-370:0| SW:ID LEU3_AGRT5 SW:DE RecName: Full=3-isopropylmalate dehydrogenase; EC=1.1.1.85;AltName: Full=Beta-IPM dehydrogenase; Short=IMDH;AltName: Full=3-IPM-DH; SW:GN Name=leuB; OrderedLocusNames=Atu2791; ORFNames=AGR_C_5067; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Cytoplasm; Leucine biosynthesis; Magnesium;Manganese; Metal-binding; NAD; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->370|LEU3_AGRT5|0.0|100.0|370/370| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 246->265|PS00470|IDH_IMDH|PDOC00389| BL:PDB:NREP 1 BL:PDB:REP 3->362|1a05A|4e-96|50.7|351/357| RP:PDB:NREP 1 RP:PDB:REP 8->363|1dr8A|e-107|49.4|338/344| RP:PFM:NREP 1 RP:PFM:REP 8->361|PF00180|2e-62|46.2|331/338|Iso_dh| HM:PFM:NREP 1 HM:PFM:REP 7->361|PF00180|8.3e-137|53.2|344/347|Iso_dh| GO:PFM:NREP 4 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00180|IPR001804| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00180|IPR001804| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00180|IPR001804| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00180|IPR001804| RP:SCP:NREP 1 RP:SCP:REP 8->364|1ai2A|8e-91|25.4|339/414|c.77.1.1| HM:SCP:REP 3->369|1a05A_|1.3e-114|44.5|357/0|c.77.1.1|1/1|Isocitrate/Isopropylmalate dehydrogenase-like| OP:NHOMO 2295 OP:NHOMOORG 1021 OP:PATTERN 11-2--2222222222-2211222211212222222222222222222323332221-1--2112-22 4443111111111121111-111113111111133322531111211-1111121111--111-13411111111111-22-422121121111---11--2-1111131--------------111111111121222332224321321122211111111112222322122222122222323311131211111111211111132222211121322--11111121-1111111111111112211-------1------------11-211-------222-1111111111-------------222222222-23-21111111111122111---2-11-311222211212-221112--32221111-1--1117441132222111111111111-23422433222-3222225424221111131241342112222222253321221111111111111111111111111111111131113543445554433333554533331333745532222553444444674333222212111111122223312311222222111-111111121111124131111111111-1111111111211122222221312312222222222222222222-1-2532-11--121221212221211122-2212211222212222222233111221211121121221211122211121-222222222222111111111222223132111113-111-1112222221112111222233232232323431-1--1---111111111111111222222222222222211112222-------------------------------------22--1-111211 ----224-21--3347867778688876645555555555455544546777886665444433454434424442433344444424-46484456664416667-3334583333223127233232Da6-5451223723641232331163313536424332A3754453333191112374986931121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 370 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHccccEEEEcccTHHHHHHHcccccHHHHHHHHHcccEEEEEcccGGGTTccGGGcHHHHHHHHHHHTTEEEEEEEEEccTTcGGGccccHHHHTTcEEEEEEEcccGGGTccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHTTcEEEEEEcTTTcHHHHHHHHHHHHHHHTTcTTcEEEEEEHHHHHHHHHHcGGGccEEEEcHHHHHHHHHHHHHTTccGGGcccEEEcTTccEEEccccEEcccccccTTTTTTTcccTHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHccccGGGcTTTTcccTHHHHHHHHHHHHHTcHH DISOP:02AL 370-371| PSIPRED ccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHcccccHHHHHHHHHccEEEEcccccccccccccccccccHHHHHHHHcccEEEEEEEEEEccccccccccccccccEEEEEEEcccccEEcccccEEEEccccccEEEEEEEEEHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccHHHHccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHcccccccccHHHHHHHHHHHHHHHcc //