[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : leuD
DDBJ      :leuD         3-isopropylmalate dehydratase, small subunit
Swiss-Prot:LEUD_AGRT5   RecName: Full=3-isopropylmalate dehydratase small subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  44/68 : Bacteria  705/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->175 2hcuA PDBj 3e-41 48.5 %
:RPS:PDB   1->177 1acoA PDBj 1e-47 23.8 %
:RPS:SCOP  1->165 1l5jA2  c.8.2.1 * 2e-39 21.2 %
:HMM:SCOP  1->199 1acoA1 c.8.2.1 * 7.6e-60 44.0 %
:RPS:PFM   3->119 PF00694 * Aconitase_C 3e-15 42.7 %
:HMM:PFM   1->122 PF00694 * Aconitase_C 2.5e-44 49.2 122/131  
:BLT:SWISS 1->201 LEUD_AGRT5 e-117 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88503.2 GT:GENE leuD GT:PRODUCT 3-isopropylmalate dehydratase, small subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2791645..2792250 GB:FROM 2791645 GB:TO 2792250 GB:DIRECTION + GB:GENE leuD GB:PRODUCT 3-isopropylmalate dehydratase, small subunit GB:PROTEIN_ID AAK88503.2 GB:DB_XREF GI:159140632 GB:GENE:GENE leuD LENGTH 201 SQ:AASEQ MEKFTKLTGVAAPMPVVNIDTDMIIPKDYLKTIKRTGLGKGLFAESRYLEDGSPNPDFVLNKPAYQNAQILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFYNNCFKNGILPVVVSPENLEKLLDDASRGSNAVLSIDLERQEISGPDGGTITFEIDEFKRHCMLNGLDDIGLTLEHAGAIDTFEKANASVRPWA GT:EXON 1|1-201:0| SW:ID LEUD_AGRT5 SW:DE RecName: Full=3-isopropylmalate dehydratase small subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuD; OrderedLocusNames=Atu2790; ORFNames=AGR_C_5065; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->201|LEUD_AGRT5|e-117|100.0|201/201| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->175|2hcuA|3e-41|48.5|171/177| RP:PDB:NREP 1 RP:PDB:REP 1->177|1acoA|1e-47|23.8|172/753| RP:PFM:NREP 1 RP:PFM:REP 3->119|PF00694|3e-15|42.7|117/130|Aconitase_C| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF00694|2.5e-44|49.2|122/131|Aconitase_C| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 1->165|1l5jA2|2e-39|21.2|151/212|c.8.2.1| HM:SCP:REP 1->199|1acoA1|7.6e-60|44.0|193/0|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 1022 OP:NHOMOORG 855 OP:PATTERN ---1----11111111-------22--12131222222222222222221332211-----1--1-22 1111111111111111111-111111111111111111221111111--111111111--111111111111111111-11-211111111111---11--1-1111111---------------11111111111222321112111111111111111111111111111111111111111111122-11111111111111111111111111111111--11111111-1111111111111111111-------1------------1111-1-------11111111111111-------------111111111-12-11-------1-12111----1-1--12112--1221112-1111--1-112111-----212221111111111111111111-11211311111-1112111111112143122111111121111111111111111-----------------------------111311143231112111111111211111-1214324411221111111111122211111211111111111111-2211112111111-1111111121111-1121111111111--1--------1-11111111111-2111111111111111111111-1-1111-11--111112121111111111-11-1111111111111111111111112121212222212112111111111-11111111111111-1---------11111111112-11111111111111111121111111221112111111-1-11-1-111111111111111111111111111111111221111-------------------------------------12--2-222111 --------------11211122212121111112222111-111111-12112111221111111111-11211211-1111111121-11121121111111112--1-------------------------------------------------------------------111911-1-2---1311122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 98.5 SQ:SECSTR cccccEEEEEEEEEccccccHHHHccTccHHHHGGGTTTTcccTTTcccccEEcHHHHHHHHHHTTccEEEEccTTcTcccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHTTcEEEEEccGGGGGGccTcccccTcEEEEEcGGGccTTTTccEEEHHHHHHHHTcHHHHHHHHHHHHHHHTcHHHHHHHHHHHH### DISOP:02AL 1-1,196-198,201-202| PSIPRED cccEEEEEEEEEEEEcccccHHHcccHHHHccccHHHHHcccccHHEEccccccccHHHHcccccccccEEEEcccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHcccccEEEEEccccEEEEccccEEEEEccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccc //