[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : lpxA
DDBJ      :lpxA         acyl-(acyl carrier protein)--UDP-N-acetylglucosamine O-acyltransferase
Swiss-Prot:LPXA_AGRT5   RecName: Full=Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase;         Short=UDP-N-acetylglucosamine acyltransferase;         EC=2.3.1.129;

Homologs  Archaea  0/68 : Bacteria  558/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->231 2jf2A PDBj 7e-50 43.0 %
:RPS:PDB   4->264 2aq9A PDBj 9e-15 39.8 %
:RPS:SCOP  8->264 1j2zA  b.81.1.1 * 3e-28 36.6 %
:HMM:SCOP  3->265 2jf2A1 b.81.1.1 * 1.3e-59 31.7 %
:HMM:PFM   19->36 PF00132 * Hexapep 6.3e-05 50.0 18/18  
:HMM:PFM   56->72 PF00132 * Hexapep 0.00053 41.2 17/18  
:BLT:SWISS 1->271 LPXA_AGRT5 e-144 100.0 %
:PROS 16->44|PS00101|HEXAPEP_TRANSFERASES
:REPEAT 2|5->80|102->182
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87176.1 GT:GENE lpxA GT:PRODUCT acyl-(acyl carrier protein)--UDP-N-acetylglucosamine O-acyltransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1378412..1379227 GB:FROM 1378412 GB:TO 1379227 GB:DIRECTION + GB:GENE lpxA GB:PRODUCT acyl-(acyl carrier protein)--UDP-N-acetylglucosamine O-acyltransferase GB:PROTEIN_ID AAK87176.1 GB:DB_XREF GI:15156450 GB:GENE:GENE lpxA LENGTH 271 SQ:AASEQ MSTIAASAKIHPTAVVEDGAVIGENVVIGALAYVGPKVTLHDDVRLHNHAVVSGLTVIGRGSVVHPMAVIGGTPQAVRHDGSETTLEIGERCIMREGVTMNAGSSDGGGKTIVGDDNLFLANSHVAHDCRLGRHIILSNNVMLAGHVTIEDRAILGGGCAVHQFTRIGRQAFIGGLSAVNYDVIPYGMLNGNPGILGGLNVVGMTRSGIERADIHKVRRVYKAIFEAEGTIRGNAAAIDRNDYLDCPQALEIIDFIGAGSDRAISSPNRGK GT:EXON 1|1-271:0| SW:ID LPXA_AGRT5 SW:DE RecName: Full=Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; Short=UDP-N-acetylglucosamine acyltransferase; EC=2.3.1.129; SW:GN Name=lpxA; OrderedLocusNames=Atu1384; ORFNames=AGR_C_2560; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Lipid A biosynthesis;Lipid synthesis; Repeat; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|LPXA_AGRT5|e-144|100.0|271/271| GO:SWS:NREP 5 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 16->44|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| NREPEAT 1 REPEAT 2|5->80|102->182| SEG 187->203|gmlngnpgilgglnvvg| BL:PDB:NREP 1 BL:PDB:REP 2->231|2jf2A|7e-50|43.0|230/264| RP:PDB:NREP 1 RP:PDB:REP 4->264|2aq9A|9e-15|39.8|259/262| HM:PFM:NREP 2 HM:PFM:REP 19->36|PF00132|6.3e-05|50.0|18/18|Hexapep| HM:PFM:REP 56->72|PF00132|0.00053|41.2|17/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 8->264|1j2zA|3e-28|36.6|254/259|b.81.1.1| HM:SCP:REP 3->265|2jf2A1|1.3e-59|31.7|262/0|b.81.1.1|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 897 OP:NHOMOORG 571 OP:PATTERN -------------------------------------------------------------------- 123-----------------------------------11-----1-------1-----------------------------221222222-3111--113222211-111111111111111211222121211----------1222222223312111112321122111111111111-----111----------------------------1---------------------------------------------------------------------------------------------------------------------------------------1------2--------12112111122222--2222311321311111111112-2212212211112111112111112211211111111212222222222312111------------1111111111111----1-----11111211212222221112222222221222211111111111211111111111112222111--111121211121--2111111123313211111-12211112222212222222223221111111121122123111111221111122122--12211------22221222222222222-222222222222222222222222222222222222222222232222222223222222222221121222224443211221-121212221122111111212311111112111222221111232323323122212222211122111111111111112122333333----------------------------------------------231 ------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------11---------1112-21--1112- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 98.9 SQ:SECSTR TTHccTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEcTTcEEccccEEccEEEEccccEEcTTcEEEEccccTTccccccEEEEccccEEcTTcEEEcccTTTTcEEEEccccEEcTTcEEcTTcEEccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEccccEEcccccTTEEEETcTTEEEEEcHHHHHHTTccHHHHHHHHHHHHHHHTccccHcHHHHHHHHHHHTTcGGGHHHHHHHHHTcccccEccc### DISOP:02AL 268-271| PSIPRED ccEEccccEEccEEEEccccEEcccEEEccccEEccccEEccccEEcccEEEcccEEEccccEEccccEEEccccccccccccccEEEccccEEccccEEEcccccccEEEEEccccEEcccEEEEEEEEcccccEEccccEEccccEEccccEEccccEEEccEEEccccEEEcccEEEcccccccEEEccccEEEEEccHHEEEccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEccccccc //