[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : lpxK
DDBJ      :lpxK         tetraacyldisaccharide 4'-kinase
Swiss-Prot:LPXK_AGRT5   RecName: Full=Tetraacyldisaccharide 4'-kinase;         EC=2.7.1.130;AltName: Full=Lipid A 4'-kinase;

Homologs  Archaea  0/68 : Bacteria  445/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:348 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  45->160 1xjcA_ c.37.1.10 * 1.2e-09 31.2 %
:RPS:PFM   17->295 PF02606 * LpxK 8e-52 44.4 %
:HMM:PFM   17->318 PF02606 * LpxK 1.1e-90 42.0 295/326  
:HMM:PFM   309->333 PF00290 * Trp_syntA 0.00079 44.0 25/259  
:BLT:SWISS 1->348 LPXK_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86507.1 GT:GENE lpxK GT:PRODUCT tetraacyldisaccharide 4'-kinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 695709..696755 GB:FROM 695709 GB:TO 696755 GB:DIRECTION + GB:GENE lpxK GB:PRODUCT tetraacyldisaccharide 4'-kinase GB:PROTEIN_ID AAK86507.1 GB:DB_XREF GI:15155661 GB:GENE:GENE lpxK LENGTH 348 SQ:AASEQ MVSEAPPFWWQKAGWQAWLLSPFSLLYGKVAGRRMRTAKRANVPVPVICIGNFTVGGAGKTPTAIAIARAAVARGMKPGFLSRGYGGTLDVTTLVDAQHHRAAAVGDEPLLLAREAVTVISRRRVEGAHRLVKEGVNLIIMDDGFQSARLTLDYALVVIDTVRGIGNGHLVPGGPVRAPLAEQMRQMTGLLKVGKGHAADPLVRQAAKAAKPVFVAAIMPQEPEDFRGKRVLAFAGIADPAKFYRTVEALGGDIVLSRSFPDHHHFSDDEIDDLLKDARKENLQLVTTAKDAVRLNGHHGRAEELLWNSQVIEIDMVFDDPNAAGTVIETAVVNCRARLLRDNARSST GT:EXON 1|1-348:0| SW:ID LPXK_AGRT5 SW:DE RecName: Full=Tetraacyldisaccharide 4'-kinase; EC=2.7.1.130;AltName: Full=Lipid A 4'-kinase; SW:GN Name=lpxK; OrderedLocusNames=Atu0697; ORFNames=AGR_C_1257; SW:KW ATP-binding; Complete proteome; Kinase; Lipid A biosynthesis;Lipid synthesis; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->348|LPXK_AGRT5|0.0|100.0|348/348| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 64->74|aiaiaraavar| SEG 206->217|aakaakpvfvaa| RP:PFM:NREP 1 RP:PFM:REP 17->295|PF02606|8e-52|44.4|275/322|LpxK| HM:PFM:NREP 2 HM:PFM:REP 17->318|PF02606|1.1e-90|42.0|295/326|LpxK| HM:PFM:REP 309->333|PF00290|0.00079|44.0|25/259|Trp_syntA| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF02606|IPR003758| GO:PFM GO:0009029|"GO:tetraacyldisaccharide 4'-kinase activity"|PF02606|IPR003758| GO:PFM GO:0009245|"GO:lipid A biosynthetic process"|PF02606|IPR003758| HM:SCP:REP 45->160|1xjcA_|1.2e-09|31.2|109/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 448 OP:NHOMOORG 448 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------------------------------111-----111-------11111-11------1111111111111111111------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11-11111111111--1111111111111111111111-1111111111111111111111111111111111111111111111111111111------------1111111111111----1-----1111111111111111111111111111111111111111-111-111-1111111-11111111-1-11111111-1----11111111111111-111-11-----------1-111111------11111111111111111111111111111111--11111------11-1111111-111111-11111111111111111111-111111----------------11111111--111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111-1111------------------------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 340-348| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccEEEcccccHHHHHHHHHHHHHccccEEEEEccccccccccEEEEcccccHHHHccHHHHHHHHccEEEEHHHHHHHHHHHHccccEEEEccccccHHHHccEEEEEEccccccccccccccccccccHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHHcccccccHHHHcccEEEEEEEEccHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHHccccEEEEcccHHHHccccccccHHHcccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccc //