[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : lrp.1
DDBJ      :lrp          transcriptional regulator, AsnC family
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  484/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->190 2gqqC PDBj 2e-24 38.6 %
:RPS:PDB   47->190 2e1cA PDBj 1e-25 26.4 %
:RPS:SCOP  47->106 1i1gA1  a.4.5.32 * 2e-22 40.0 %
:RPS:SCOP  108->194 2cg4A2  d.58.4.2 * 4e-16 15.3 %
:HMM:SCOP  45->107 2cg4A1 a.4.5.32 * 6.9e-23 57.1 %
:HMM:SCOP  107->196 1ri7A2 d.58.4.2 * 3.8e-15 25.6 %
:RPS:PFM   51->92 PF08279 * HTH_11 1e-05 47.6 %
:HMM:PFM   114->186 PF01037 * AsnC_trans_reg 8.4e-15 25.0 72/74  
:HMM:PFM   52->94 PF01047 * MarR 1.8e-06 32.6 43/59  
:BLT:SWISS 42->196 LRP_RHIME 8e-67 80.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87930.1 GT:GENE lrp.1 GT:PRODUCT transcriptional regulator, AsnC family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2160439..2161029) GB:FROM 2160439 GB:TO 2161029 GB:DIRECTION - GB:GENE lrp GB:PRODUCT transcriptional regulator, AsnC family GB:PROTEIN_ID AAK87930.1 GB:DB_XREF GI:15157332 GB:GENE:GENE lrp LENGTH 196 SQ:AASEQ MRYQQGSCGCVRNFVTGRWHNVANPAPNSTRKFSSLTRYFSVTSVELDAIDLKILRELQRDGRMTNVELAERVGISAPPCLRRVRKLEEADVIQGYHAMLNAPKLGFDLVAFCMIGLKRQSDSNLKAFAAATGGWSLVRQAWMVSGESDFLLHCVAKNLTEFQDFVIEVLTADENVDTVRTMLTIRQVKRVGLVEI GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 42->196|LRP_RHIME|8e-67|80.6|155/156| BL:PDB:NREP 1 BL:PDB:REP 46->190|2gqqC|2e-24|38.6|145/157| RP:PDB:NREP 1 RP:PDB:REP 47->190|2e1cA|1e-25|26.4|140/147| RP:PFM:NREP 1 RP:PFM:REP 51->92|PF08279|1e-05|47.6|42/52|HTH_11| HM:PFM:NREP 2 HM:PFM:REP 114->186|PF01037|8.4e-15|25.0|72/74|AsnC_trans_reg| HM:PFM:REP 52->94|PF01047|1.8e-06|32.6|43/59|MarR| RP:SCP:NREP 2 RP:SCP:REP 47->106|1i1gA1|2e-22|40.0|60/60|a.4.5.32| RP:SCP:REP 108->194|2cg4A2|4e-16|15.3|85/86|d.58.4.2| HM:SCP:REP 45->107|2cg4A1|6.9e-23|57.1|63/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 107->196|1ri7A2|3.8e-15|25.6|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 2118 OP:NHOMOORG 518 OP:PATTERN ---------------211111111-11--11----11----11---1-------3121222---1-11 -2--7---222---3--23-22--212222221111144311--31---11-422121--3351614633------------------1111-2--1--11424143516---------------11111111111-------------1----------------1----------------422-------1222222211212111-32223122---2111------21---------------------------1-----11----------------------------------------------------------11---1-11-1-12-------1-----11-221--------------2--9885111-142A69222544737777777677A-116119155G2-FAA9EENEEHAA7354349D56458DG2222222245531177------------------------------15F62ABBABKIIJJJFCCCBEFDDEEEE8DGIF7898-177B48A788593C2332----522222212---141--1-111--12----2-1----------2----------------------------11554221638623344323522224354233--1----------23552232222222222-2222222222222222222545333233234333343243444522222221-422222222222---3-----2222-153D2222322333411129A889751213277879B5B48B773899---------144445455486A764422222222--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1--------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 87.8 SQ:SECSTR ########################EETTEEEEEcTTccTHHHHHccccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHHTHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHTHHHHHHcTTEEEEEEEEccccccccccccc DISOP:02AL 1-6, 21-40| PSIPRED ccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEcHHHccccEEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccc //