[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : motA
DDBJ      :motA         flagellar motor protein
Swiss-Prot:MOTA_AGRT5   RecName: Full=Chemotaxis protein motA;AltName: Full=Motility protein A;

Homologs  Archaea  0/68 : Bacteria  278/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:290 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   133->194 PF01618 * MotA_ExbB 2e-04 29.0 %
:HMM:PFM   130->225 PF01618 * MotA_ExbB 3.3e-11 25.0 96/139  
:BLT:SWISS 1->290 MOTA_AGRT5 e-156 100.0 %
:PROS 205->222|PS01307|MOTA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86372.1 GT:GENE motA GT:PRODUCT flagellar motor protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 545748..546620 GB:FROM 545748 GB:TO 546620 GB:DIRECTION + GB:GENE motA GB:PRODUCT flagellar motor protein GB:PROTEIN_ID AAK86372.1 GB:DB_XREF GI:15155498 GB:GENE:GENE motA LENGTH 290 SQ:AASEQ MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGFIMANPMKVVKDSGKALGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNKELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAAVLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYIIVKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA GT:EXON 1|1-290:0| SW:ID MOTA_AGRT5 SW:DE RecName: Full=Chemotaxis protein motA;AltName: Full=Motility protein A; SW:GN Name=motA; OrderedLocusNames=Atu0560; ORFNames=AGR_C_985; SW:KW Cell inner membrane; Cell membrane; Chemotaxis; Complete proteome;Flagellar rotation; Hydrogen ion transport; Ion transport; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->290|MOTA_AGRT5|e-156|100.0|290/290| GO:SWS:NREP 9 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0001539|"GO:ciliary or flagellar motility"|Flagellar rotation| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 205->222|PS01307|MOTA|PDOC01011| TM:NTM 4 TM:REGION 1->23| TM:REGION 29->51| TM:REGION 170->192| TM:REGION 196->218| SEG 197->208|vlggligaalvg| RP:PFM:NREP 1 RP:PFM:REP 133->194|PF01618|2e-04|29.0|62/132|MotA_ExbB| HM:PFM:NREP 1 HM:PFM:REP 130->225|PF01618|3.3e-11|25.0|96/139|MotA_ExbB| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF01618|IPR002898| GO:PFM GO:0008565|"GO:protein transporter activity"|PF01618|IPR002898| GO:PFM GO:0016020|"GO:membrane"|PF01618|IPR002898| OP:NHOMO 315 OP:NHOMOORG 281 OP:PATTERN -------------------------------------------------------------------- 112--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1---1-------------11-11111----111------1--111111111111-11111-1211111111111111111-1211121111111--------1111-121--------------------------------111111111111212111111221112122111111--111111111--111111111121-------111-111-------13-1111-1--111--------1-----------------------------1--1-----1-----1-1---1--1111-----111------21111111111111111-1211211111112111111---1111111111111111111111--2111111121222121222---------2221--111-------------------------1111111111211111111---------2---1-----11---1111111111-------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 276-290| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHHccccccc //