[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : motB.1
DDBJ      :motB         flagellar motor protein, PAL/OmpA family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  240/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.7
:433 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   266->428 2zvyA PDBj 3e-11 31.1 %
:RPS:PDB   326->428 3cypD PDBj 2e-15 21.4 %
:RPS:SCOP  326->427 1oapA  d.79.7.1 * 2e-16 22.2 %
:HMM:SCOP  309->428 1r1mA_ d.79.7.1 * 8e-17 29.2 %
:RPS:PFM   326->424 PF00691 * OmpA 6e-05 34.0 %
:HMM:PFM   326->417 PF00691 * OmpA 1.1e-13 27.6 87/97  
:BLT:SWISS 11->260 LAFU_VIBPA 7e-10 22.7 %
:BLT:SWISS 313->428 MBHA_ECOLI 1e-15 36.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86380.1 GT:GENE motB.1 GT:PRODUCT flagellar motor protein, PAL/OmpA family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 553440..554741 GB:FROM 553440 GB:TO 554741 GB:DIRECTION + GB:GENE motB GB:PRODUCT flagellar motor protein, PAL/OmpA family GB:PROTEIN_ID AAK86380.1 GB:DB_XREF GI:15155508 GB:GENE:GENE motB LENGTH 433 SQ:AASEQ MSEGENHHHGKNEIIIVKRHKGGHDGAHGGAWKIAYADFMTAMMAFFLVMWLVNAANEETKASVASYFNPIKLSDEKPSSKGLEKPADKEEGVQKKDQSNIQAEKVTKGSAAATGEDLTSQTGEQSNFSEADFFENPYSVLAEIAQQVGQQANVSAKGEGGAADSGPATGASGGEAYRDPFDPDFWTQQVKITRADQKQVPSEAAQAADGKQQDVAAKEADKSAEAVTLVQAGKPADKAEDGKSMEIAAVVPQQRPDAAEQAALAKPNPDQASKASDAEWEKADTLREEIEKQISGITGKLSEGLVVTPAEGGLLLTISDQAETPMFNIGSAVPRGELVLAMEKIGKLLQERGGSVVIRGHTDGRQFKGEANDNWRLSMDRAHSAYYMLVRGGLSEERVKQVSGFADRRLQVPSNPLADANRRIEILLEADRG GT:EXON 1|1-433:0| BL:SWS:NREP 2 BL:SWS:REP 11->260|LAFU_VIBPA|7e-10|22.7|245/330| BL:SWS:REP 313->428|MBHA_ECOLI|1e-15|36.2|116/211| TM:NTM 1 TM:REGION 37->59| SEG 22->31|gghdgahgga| BL:PDB:NREP 1 BL:PDB:REP 266->428|2zvyA|3e-11|31.1|161/183| RP:PDB:NREP 1 RP:PDB:REP 326->428|3cypD|2e-15|21.4|103/132| RP:PFM:NREP 1 RP:PFM:REP 326->424|PF00691|6e-05|34.0|94/97|OmpA| HM:PFM:NREP 1 HM:PFM:REP 326->417|PF00691|1.1e-13|27.6|87/97|OmpA| GO:PFM:NREP 1 GO:PFM GO:0009279|"GO:cell outer membrane"|PF00691|IPR006665| RP:SCP:NREP 1 RP:SCP:REP 326->427|1oapA|2e-16|22.2|99/108|d.79.7.1| HM:SCP:REP 309->428|1r1mA_|8e-17|29.2|113/140|d.79.7.1|1/1|OmpA-like| OP:NHOMO 296 OP:NHOMOORG 240 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11111----111-----13-131111111-111-22222-2211111111111111111-121---111111---------1111-121--------------------------------111111111111212-11111221112121111111--111111111--11-11211-121-------111-11------1-111111----------------1-----------------------------1--1-----1-----1-1---1--1-11-----111------1-111111222122222-2212222222222121112---11111-1--------------1--12222-1121222121222---------1111--111-------------------------1111111--1211111------------1---------11---1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 38.3 SQ:SECSTR #########################################################################################################################################################################################################################################################################HHHHHHHHHHH##HHHHHHHHHHHHHHHHHHcHHTTGGGEEEEEETTccHHHHTTTccEEcccTTcccccHHHHHHHHHHHHHHHHccTEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHTTccGGGEEEEEcTTcccccccccHHHHHHcEEEEEEEccHH DISOP:02AL 1-13, 21-27, 72-131, 193-305, 432-433| PSIPRED cccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEccccccccccccccccccEEEEEEEcccc //