[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : mucS
DDBJ      :mucS         exopolysaccharide II synthesis transcriptional activator ExpG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->169 2a61A PDBj 1e-06 20.6 %
:RPS:SCOP  53->158 2bv6A1  a.4.5.28 * 1e-07 16.7 %
:HMM:SCOP  14->164 2fbkA1 a.4.5.28 * 6.3e-21 28.8 %
:HMM:PFM   55->111 PF01047 * MarR 5.3e-08 29.8 57/59  
:BLT:SWISS 41->168 EXPG_RHIME 2e-12 31.5 %
:PROS 85->119|PS01117|HTH_MARR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86967.1 GT:GENE mucS GT:PRODUCT exopolysaccharide II synthesis transcriptional activator ExpG GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1157537..1158049 GB:FROM 1157537 GB:TO 1158049 GB:DIRECTION + GB:GENE mucS GB:PRODUCT exopolysaccharide II synthesis transcriptional activator ExpG GB:PROTEIN_ID AAK86967.1 GB:DB_XREF GI:15156203 GB:GENE:GENE mucS LENGTH 170 SQ:AASEQ MINSKVKPQAVVADAHEDTIRSLYMESLHLVERLHRRLLDVIKDEFDRQGRDDVNAVQALLLFNIGNSELTAGELRSRGYYLGSNVSYNVKKLVDLGLINHQRSRVDRRSVRISLTEEGQAIAETVARLYERHVGSIEKVGGIGTGEFSEMNKLLQRLDRFWNDSIAYRL GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 41->168|EXPG_RHIME|2e-12|31.5|124/194| PROS 85->119|PS01117|HTH_MARR_1|PDOC00861| SEG 28->39|lhlverlhrrll| SEG 103->112|rsrvdrrsvr| RP:PDB:NREP 1 RP:PDB:REP 42->169|2a61A|1e-06|20.6|126/142| HM:PFM:NREP 1 HM:PFM:REP 55->111|PF01047|5.3e-08|29.8|57/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 53->158|2bv6A1|1e-07|16.7|102/136|a.4.5.28| HM:SCP:REP 14->164|2fbkA1|6.3e-21|28.8|146/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 69 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111112-1111111111111111111111221-1111111111111-------------121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 75.3 SQ:SECSTR #########################################HHHHHHTTHHHTccHHHHHHHHHHHHHcccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTHHHHcHHHHHHHHHHHHHHHHHHHHHTTcc# DISOP:02AL 1-14| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHccHHHHHccHHccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHcc //