[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : murD
DDBJ      :murD         UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
Swiss-Prot:MURD_AGRT5   RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;         EC=6.3.2.9;AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;AltName: Full=D-glutamic acid-adding enzyme;

Homologs  Archaea  0/68 : Bacteria  827/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.5.1c.59.1c.72.2
:469 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->449 2vteA PDBj 1e-32 33.3 %
:RPS:PDB   38->116 3e68A PDBj 3e-09 21.1 %
:RPS:PDB   115->465 1e8cB PDBj 9e-42 13.5 %
:RPS:SCOP  99->314 1e0dA3  c.72.2.1 * 6e-32 30.3 %
:RPS:SCOP  316->456 1e0dA2  c.59.1.1 * 7e-27 31.1 %
:HMM:SCOP  5->98 2uagA1 c.5.1.1 * 6.7e-15 37.8 %
:HMM:SCOP  104->314 2uagA3 c.72.2.1 * 1e-53 40.1 %
:HMM:SCOP  316->457 2uagA2 c.59.1.1 * 9.1e-38 49.6 %
:RPS:PFM   119->241 PF08245 * Mur_ligase_M 6e-09 37.8 %
:HMM:PFM   119->297 PF08245 * Mur_ligase_M 3.7e-42 36.1 169/188  
:HMM:PFM   318->359 PF02875 * Mur_ligase_C 2.1e-08 34.1 41/91  
:HMM:PFM   5->61 PF02826 * 2-Hacid_dh_C 1.2e-05 28.1 57/178  
:BLT:SWISS 1->469 MURD_AGRT5 0.0 100.0 %
:PROS 121->136|PS00012|PHOSPHOPANTETHEINE
:PROS 117->140|PS01011|FOLYLPOLYGLU_SYNT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87846.1 GT:GENE murD GT:PRODUCT UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2059742..2061151) GB:FROM 2059742 GB:TO 2061151 GB:DIRECTION - GB:GENE murD GB:PRODUCT UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase GB:PROTEIN_ID AAK87846.1 GB:DB_XREF GI:15157230 GB:GENE:GENE murD LENGTH 469 SQ:AASEQ MIPVTSFRGKKVALFGLGGSGLVTARALVAGGAAVVAFDDNPDSVAKAQAEGIATADLHTIDWSSFSSFVLAPGVPLTHPKPHWSVDLAKAAGVEVIGDIELFIRERRVHAPDCPFIAITGTNGKSTTTALIAHILQSSGRDTQLGGNIGTAVLSLDPPKAQRFYVVECSSYQIDLAPTINPTAGILLNLTPDHLDRHGTMQHYADVKERLVAGSGTAIVGVDDSHSTLIADRIERAGVKVERISKRNVVSEGLYAEGSQILRAHGGTSSLLVDLDGIQTLRGSHNAQNAAAAIAACLAVGVSEEEIRAGLKSFPGLKHRMQPVGRRGNVTFVNDSKATNADAAAPALSSFDRIYWIAGGLPKAGGITSLSPLFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLDKAVQHAAADAEKDATAGNVVMLSPACASFDQYKNFEIRGDSFVAQVAALEGMTMLVHSGKGG GT:EXON 1|1-469:0| SW:ID MURD_AGRT5 SW:DE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase; EC=6.3.2.9;AltName: Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;AltName: Full=D-glutamic acid-adding enzyme; SW:GN Name=murD; OrderedLocusNames=Atu2096; ORFNames=AGR_C_3803; SW:KW ATP-binding; Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->469|MURD_AGRT5|0.0|100.0|469/469| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| PROS 121->136|PS00012|PHOSPHOPANTETHEINE|PDOC00012| PROS 117->140|PS01011|FOLYLPOLYGLU_SYNT_1|PDOC00773| SEG 21->37|glvtaralvaggaavva| SEG 287->299|aqnaaaaiaacla| SEG 385->397|eaaaefaatlgea| SEG 407->423|dkavqhaaadaekdata| BL:PDB:NREP 1 BL:PDB:REP 62->449|2vteA|1e-32|33.3|357/432| RP:PDB:NREP 2 RP:PDB:REP 38->116|3e68A|3e-09|21.1|76/415| RP:PDB:REP 115->465|1e8cB|9e-42|13.5|342/484| RP:PFM:NREP 1 RP:PFM:REP 119->241|PF08245|6e-09|37.8|119/187|Mur_ligase_M| HM:PFM:NREP 3 HM:PFM:REP 119->297|PF08245|3.7e-42|36.1|169/188|Mur_ligase_M| HM:PFM:REP 318->359|PF02875|2.1e-08|34.1|41/91|Mur_ligase_C| HM:PFM:REP 5->61|PF02826|1.2e-05|28.1|57/178|2-Hacid_dh_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 2 RP:SCP:REP 99->314|1e0dA3|6e-32|30.3|195/196|c.72.2.1| RP:SCP:REP 316->456|1e0dA2|7e-27|31.1|135/140|c.59.1.1| HM:SCP:REP 5->98|2uagA1|6.7e-15|37.8|90/93|c.5.1.1|1/1|MurCD N-terminal domain| HM:SCP:REP 104->314|2uagA3|1e-53|40.1|202/204|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 316->457|2uagA2|9.1e-38|49.6|133/140|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 985 OP:NHOMOORG 834 OP:PATTERN -------------------------------------------------------------------- 11112321-1112-11111-1211111111111111111111-111121112211111111-11221211111111111-2111211-111111111--11111111321112221111-11111122-2221212---------11111111111111111111111111111111111111111111122111111111111111111111111111112111122221211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112223211111111111111332211211122121112111211112311111-111211111111212121211111111111111-111111111221211121111111112211111111111111111112111122211--------11111111111111111111222222111-2222222111122111111112211111311---111111122111221111211121112222222111111111111112321212121111131111---11111----------12-11111111211111111111212111111211111-1111112-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111122221231111111111111111122222211111211111111111111111111111111111112222233222111-1--1112212112-111111---1-111----------------------------2111111111-11 --------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1---1------1--1--2--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 465 STR:RPRED 99.1 SQ:SECSTR cccccccTTccEEEEcccHHHHHHHHHHHTTTcccEEEEcccccTTGGGccTTcccccccccGGGGHHHHHHHTccEEEEccccccEEEcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHTTccEEEcTTccEETTcccccccccccHHHHHHHHHHHTTccEEEEccHHHHHTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHcccccEEEEETTcHHHHHHHTTcTTcEEEEcccccTTTccEEEEEEEccEEEccccEEEEEEETTccEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTccEEEEEccccHHHHHHHHHHccccEEEEEccccccccTHHHHHHHHHHHccEEEEcHHHHHHHHHTTccTTccEEccHccTHHHHHHHHHHHccTTcEEEEEcEccTTccEEEETTEEEEccHHHHHHHHHTcccTT#### DISOP:02AL 1-4, 468-469| PSIPRED cccccHHcccEEEEEEEcHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccEEEEEccccccccccEEEEEcccccccccHHHHHHHHHHccccEEcHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEccccHHHHHccccccccEEEEEcccccHHHHHcccccEEEEEcccHHHHHHcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEEEcccccEEEEcEEEcccEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccEEEEEEcccccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHEEEEEcccHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEcccc //