[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : murG
DDBJ      :murG         UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
Swiss-Prot:MURG_AGRT5   RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase;         EC=2.4.1.227;AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase;

Homologs  Archaea  0/68 : Bacteria  805/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->286 1nlmA PDBj 2e-35 35.3 %
:RPS:PDB   6->287 3d0qA PDBj 1e-15 15.4 %
:RPS:SCOP  6->287 1f0kA  c.87.1.2 * 4e-53 33.3 %
:HMM:SCOP  4->364 1f0kA_ c.87.1.2 * 5.1e-95 43.0 %
:RPS:PFM   6->134 PF03033 * Glyco_transf_28 1e-21 45.2 %
:RPS:PFM   186->334 PF04101 * Glyco_tran_28_C 3e-20 36.3 %
:HMM:PFM   187->351 PF04101 * Glyco_tran_28_C 1e-36 37.2 164/167  
:HMM:PFM   6->141 PF03033 * Glyco_transf_28 2.6e-30 37.7 130/139  
:BLT:SWISS 1->378 MURG_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87844.1 GT:GENE murG GT:PRODUCT UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2057440..2058576) GB:FROM 2057440 GB:TO 2058576 GB:DIRECTION - GB:GENE murG GB:PRODUCT UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase GB:PROTEIN_ID AAK87844.1 GB:DB_XREF GI:15157228 GB:GENE:GENE murG LENGTH 378 SQ:AASEQ MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISVVRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKAIAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQTGETFQLVVFGGSQGAQFFSSAVPAAICLMKDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRPSILVPYPHALDHDQAANAAALSAAGGASVIKQAELSPQKLSSLLSSALAEPDRLSATAAAAKATGKPHAADVLADLVEAIAEGRSVQEFKKKNEGVGA GT:EXON 1|1-378:0| SW:ID MURG_AGRT5 SW:DE RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; EC=2.4.1.227;AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase; SW:GN Name=murG; OrderedLocusNames=Atu2094; ORFNames=AGR_C_3798; SW:KW Cell cycle; Cell division; Cell inner membrane; Cell membrane;Cell shape; Cell wall biogenesis/degradation; Complete proteome;Glycosyltransferase; Membrane; Peptidoglycan synthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->378|MURG_AGRT5|0.0|100.0|378/378| GO:SWS:NREP 10 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 288->308|haldhdqaanaaalsaaggas| SEG 320->329|lssllssala| SEG 336->350|ataaaakatgkphaa| BL:PDB:NREP 1 BL:PDB:REP 6->286|1nlmA|2e-35|35.3|272/350| RP:PDB:NREP 1 RP:PDB:REP 6->287|3d0qA|1e-15|15.4|272/369| RP:PFM:NREP 2 RP:PFM:REP 6->134|PF03033|1e-21|45.2|126/138|Glyco_transf_28| RP:PFM:REP 186->334|PF04101|3e-20|36.3|146/162|Glyco_tran_28_C| HM:PFM:NREP 2 HM:PFM:REP 187->351|PF04101|1e-36|37.2|164/167|Glyco_tran_28_C| HM:PFM:REP 6->141|PF03033|2.6e-30|37.7|130/139|Glyco_transf_28| GO:PFM:NREP 7 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03033|IPR004276| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF03033|IPR004276| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF03033|IPR004276| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF04101|IPR007235| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF04101|IPR007235| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF04101|IPR007235| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF04101|IPR007235| RP:SCP:NREP 1 RP:SCP:REP 6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2| HM:SCP:REP 4->364|1f0kA_|5.1e-95|43.0|349/0|c.87.1.2|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 850 OP:NHOMOORG 813 OP:PATTERN -------------------------------------------------------------------- 111-1111111111-11----11111-----111-1-1--11131--11-1-11----112211111112111111111111-11111111111111--111111111111111111111111111111111111111-11---1-111111111--11111111111111111111111111111--11111122222322132233211111123311111111111111-1111111111111111111111111111111111111111111111---1111111----111-1-1111111111111--11---111111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111----1111111111111111111111111111111111111111111111111111111111111111111111111111-1--11111111111111111---1-----1---------------------------111-1-111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---18-----1--1-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 75.9 SQ:SECSTR ccccEEEEEccccTTccHHHHHHHHHHHHTTcEEEEEEcccHHHHHTHHHHHHcTTTTTTGGGcccGGGGHHHHHHHHGGGHHHHHHHHHHcccEEEEETTcHHHHHHHHHHTccEEEEcccccccTTHHHHHTTcHHHHHTTcccccccGGGcccccTTEEEccccccccccccccccccccccEEEEEcHHHHHHHccGGGHHHHHHHTTcccEEEEEcTTcccGGGccHHHHHHTTcccTTEEEcccccHHHHHTTEEEEEcccHHHHHHHHTHTccEEEcccT########################################################################################### DISOP:02AL 337-346, 363-378| PSIPRED ccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcEEEEcccHHHcccccccEEEEEccccHHHcccccHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHccccEEEEEccccHHHHHHHccEEEEcccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccc //