[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_AGRT5    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  63/68 : Bacteria  799/915 : Eukaryota  195/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:140 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->138 1nhkL PDBj 3e-45 62.8 %
:RPS:PDB   4->139 2cwkB PDBj 1e-51 44.1 %
:RPS:SCOP  1->139 1b4sA  d.58.6.1 * 2e-48 43.2 %
:HMM:SCOP  1->140 1w7wA_ d.58.6.1 * 1.2e-52 51.4 %
:RPS:PFM   4->135 PF00334 * NDK 2e-36 58.3 %
:HMM:PFM   4->138 PF00334 * NDK 4.3e-56 57.8 135/135  
:BLT:SWISS 1->140 NDK_AGRT5 4e-77 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86926.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1113392..1113814 GB:FROM 1113392 GB:TO 1113814 GB:DIRECTION + GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:PROTEIN_ID AAK86926.1 GB:DB_XREF GI:15156156 GB:GENE:GENE ndk LENGTH 140 SQ:AASEQ MAIERTFSMIKPDATKRNLTGAITKVFEDNGLRIVASKRVWMSKREAEGFYAVHKERPFFGELVEGMTSGPTIVQVLEGENAILKNREIMGATNPAQAAEGTIRKSFALSIGENSVHGSDAPETAAQEIAYWFAETEIVG GT:EXON 1|1-140:0| SW:ID NDK_AGRT5 SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=Atu1122; ORFNames=AGR_C_2077; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|NDK_AGRT5|4e-77|100.0|140/140| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 2->138|1nhkL|3e-45|62.8|137/143| RP:PDB:NREP 1 RP:PDB:REP 4->139|2cwkB|1e-51|44.1|136/152| RP:PFM:NREP 1 RP:PFM:REP 4->135|PF00334|2e-36|58.3|132/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 4->138|PF00334|4.3e-56|57.8|135/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->139|1b4sA|2e-48|43.2|139/150|d.58.6.1| HM:SCP:REP 1->140|1w7wA_|1.2e-52|51.4|140/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1596 OP:NHOMOORG 1058 OP:PATTERN 11-1111111111111-1-111111111111111111111111111111111111111111111--11 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111-----111 1122334-51113341111111111111111111111111111111-11111111111121111111111111111111111111111-111111122211135331363B8A88BA4373392BA3B6aZE-C7C4446C44CA46742725C3946799645571223211742443O22232A5881583333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 140 STR:RPRED 100.0 SQ:SECSTR cTTEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGccc PSIPRED cccEEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHccccccccHHcccccccEEcccccHHHHHHHHHHHccHHHHcc //