[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : nocP1
DDBJ      :nocP1        ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:258 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   9->253 1b0uA PDBj 1e-74 60.4 %
:RPS:PDB   8->247 3b5jA PDBj 4e-38 18.9 %
:RPS:SCOP  9->256 1b0uA  c.37.1.12 * 7e-47 55.6 %
:HMM:SCOP  13->240 1ii8.1 c.37.1.12 * 3.1e-69 37.0 %
:RPS:PFM   48->183 PF00005 * ABC_tran 4e-11 39.2 %
:HMM:PFM   48->183 PF00005 * ABC_tran 1.8e-23 37.1 116/118  
:HMM:PFM   148->220 PF02463 * SMC_N 2.8e-05 19.4 72/220  
:HMM:PFM   36->54 PF00485 * PRK 0.00033 52.6 19/194  
:BLT:SWISS 9->253 AOTP_PSEAE 1e-74 60.4 %
:PROS 155->169|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88106.1 GT:GENE nocP1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2340711..2341487) GB:FROM 2340711 GB:TO 2341487 GB:DIRECTION - GB:GENE nocP1 GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK88106.1 GB:DB_XREF GI:15157538 GB:GENE:GENE nocP1 LENGTH 258 SQ:AASEQ MTDKGACALEADDIHKSFGTHEVLKGVSLKAHKGDVISIIGSSGSGKSTFLRCINFLETPDRGRVIVNGEEIATKMGRDGKAVPKSWRQVEKLRTGLGMVFQNFNLWAHRTVLENVIEAPVHVLGVRRHEAVEKAEALLNKVGLYDKKNAYPAFLSGGQQQRAAIARALCMEPAVMLFDEPTSALDPELVGEVLKVIRDLAEEGRTMLLVTHEMRFARDVSTEVMFLHQGRVEETGPPAQVFGNPLSARCREFTGALA GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 9->253|AOTP_PSEAE|1e-74|60.4|245/254| PROS 155->169|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 37->46|isiigssgsg| SEG 159->168|qqqraaiara| BL:PDB:NREP 1 BL:PDB:REP 9->253|1b0uA|1e-74|60.4|245/258| RP:PDB:NREP 1 RP:PDB:REP 8->247|3b5jA|4e-38|18.9|228/243| RP:PFM:NREP 1 RP:PFM:REP 48->183|PF00005|4e-11|39.2|120/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 48->183|PF00005|1.8e-23|37.1|116/118|ABC_tran| HM:PFM:REP 148->220|PF02463|2.8e-05|19.4|72/220|SMC_N| HM:PFM:REP 36->54|PF00485|0.00033|52.6|19/194|PRK| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 9->256|1b0uA|7e-47|55.6|248/258|c.37.1.12| HM:SCP:REP 13->240|1ii8.1|3.1e-69|37.0|219/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 32519 OP:NHOMOORG 1134 OP:PATTERN NME9LIDBLJJIMGNEgEOOKMJPkIKVbHYMC7C9C8EFHDBNUIPVHM*ra7PSOLQIHAC5V199 LRRE*ONRUUXENIMKJGF-FV66M*GGGGGFjcdda***LiMuhoiSZUNGjkeFKQ77chdPsdp***VTPPPhSSQGbMdA7A8BHHHD3D89A--7AEBDEMFHCD45555558986666BPGEJMDCLNLGXcdjlBBBdQWQWZPPXUZLMFCDCEBMQRTkhfLAD78988E9899WQPMLXW6KNgqrvqvqy*n**wtv**offhh***RWh*mUVcaaYZY**MSSSSRPRQQSSSQONPNNKdSLPfgPINMOYXIJgjMLLMVQTXXbacXcbfcbccebdaZcdbbbPOOONPQQQQPOOgWTRQRXWXVQ*fpxrtruswpUtUUlppNTSOxYXYUyNUPJ**bfSUWfORWSbTHOSKHPOMMHDEECETO***KGh*vu*n**z**w*sz**-ad*YT*X***M7**************9CIx*********KJKKKKKKjQTCKaNv44444444432234444344343345354H9ADBA***x*******ljjlh****rnppWq***z**t8Kmmlwafhl*u****PbVILFFaMFFFEEEDKJJTfcSo*LTPgeNYgXVjEWRVPPQYMQNOJPekQr6EEIBCCCDAC686776776AHA8AIHfdkCgKPDHDeIMNPLEIQKKKJIMMMLQJ5-6CPIH1-----uo**Pwifjjiglilef-jfdhghjghgkkfcdeccg*****WWRddYabdcccdZacaaa*caVbcadM1rz*****w****23DCBCABCIHHIHDqc*ONNOMQEIIHHQGLSJKLJKAMDILbQggegk***jvvmpa***CBB9ACBBBGPcbhbdcdchphmlLLMGGGGEGE9BAB34FMFFCCEF56676676Z9I76936-75979B7777589777666KUWIJatdabCRG ----671-42-4-342-1--23231323332-21321433211-1112112322222-111---1-11-11111111-11----1----112-21-22212-1---1323A766789434-3D4LI1K1S*H-E9A7243C25DA48328E43b3A98P3-c4K665C9DSACE25232Q22136B22J16441G3871 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccEEEEEEEEEEEEccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEccEEEccccccccccccccHHHHHHHHHHccEEEEcHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHcc //