[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : nolR
DDBJ      :nolR         transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  313/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->96 3cuoA PDBj 2e-15 46.8 %
:RPS:PDB   22->98 1bibA PDBj 6e-12 14.3 %
:RPS:SCOP  1->88 1fnnA1  a.4.5.11 * 4e-14 15.9 %
:HMM:SCOP  8->99 1u2wA1 a.4.5.5 * 2.3e-23 40.2 %
:RPS:PFM   22->66 PF01022 * HTH_5 3e-06 53.3 %
:HMM:PFM   22->68 PF01022 * HTH_5 1.9e-14 48.9 47/47  
:BLT:SWISS 8->95 NOLR_RHIME 1e-28 71.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88019.2 GT:GENE nolR GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2250077..2250397) GB:FROM 2250077 GB:TO 2250397 GB:DIRECTION - GB:GENE nolR GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAK88019.2 GB:DB_XREF GI:159140408 GB:GENE:GENE nolR LENGTH 106 SQ:AASEQ MDNQSLSEHSIAAADLLSAMANPKRLMILCTLVDTEVPVGVLASQVGLSQSALSQHLSKLRAQRLVKTRRDAQTIYYSSNSESVKKILASLEDIYCQAQKSSKTAA GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 8->95|NOLR_RHIME|1e-28|71.6|88/122| BL:PDB:NREP 1 BL:PDB:REP 20->96|3cuoA|2e-15|46.8|77/98| RP:PDB:NREP 1 RP:PDB:REP 22->98|1bibA|6e-12|14.3|77/294| RP:PFM:NREP 1 RP:PFM:REP 22->66|PF01022|3e-06|53.3|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 22->68|PF01022|1.9e-14|48.9|47/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 1->88|1fnnA1|4e-14|15.9|88/103|a.4.5.11| HM:SCP:REP 8->99|1u2wA1|2.3e-23|40.2|92/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 422 OP:NHOMOORG 314 OP:PATTERN -------------------------------------------------------------------- --1-----------11111-11--1-1111111111-121------------1-----------------------------1----------------------------------------------1-------------------------------------------------------1---------------------------------11-----------1---------------------------------------------------------------------------------------------11-------1-1----1--1-----1----11---1----11--------2111-----112331124143122222222223-2412613--31-322433244222111221--1111112--------1----122------------------------------1-2--111-11--11111111---11111-211--11211111---221-1-1-1211-1123-------111-12-11-1----------------------------------------------------112211-1111112222222222222222222----111--------111--1111111111-111111111111111111111111--1111111111111111111111111--1--------------1---------111-1111------------111111111-11------1-1----1---1-111111-1-111222222212211--1-----111111--11--------------1--------------------------1--1-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 94.3 SQ:SECSTR EEETHHHEEEEccHHHHHccHcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEHH###### DISOP:02AL 1-8,97-107| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHHHHHHccccccccccc //