[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : nusG.1
DDBJ      :nusG         transcription antitermination protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  175/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.58.42
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->114 2k06A PDBj 7e-07 36.3 %
:BLT:PDB   127->179 1nz9A PDBj 1e-04 40.0 %
:RPS:PDB   59->154 2ckkA PDBj 1e-08 8.0 %
:RPS:PDB   125->188 2e70A PDBj 1e-04 14.8 %
:RPS:SCOP  12->119 1m1gA3  d.58.42.1 * 4e-14 18.0 %
:RPS:SCOP  126->188 1m1gA2  b.34.5.4 * 2e-06 27.3 %
:HMM:SCOP  12->117 1nz8A_ d.58.42.1 * 1.6e-18 36.2 %
:HMM:SCOP  123->188 1m1gA2 b.34.5.4 * 4.8e-05 24.1 %
:RPS:PFM   15->104 PF02357 * NusG 9e-09 36.0 %
:HMM:PFM   14->104 PF02357 * NusG 1.2e-19 40.4 89/92  
:BLT:SWISS 14->179 NUSG_RICTY 8e-13 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86266.2 GT:GENE nusG.1 GT:PRODUCT transcription antitermination protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 444726..445292 GB:FROM 444726 GB:TO 445292 GB:DIRECTION + GB:GENE nusG GB:PRODUCT transcription antitermination protein GB:PROTEIN_ID AAK86266.2 GB:DB_XREF GI:159139634 GB:GENE:GENE nusG LENGTH 188 SQ:AASEQ MLSMAAENQPGKHEWFVVETKHKAEKAVEDALRKAGVKVFLPLETIGETVVRGRIIPAVSRPLLPGYVLVNIVYSPAAVCGIARLEGVAGFVGGMVHPHRVSDEEMNRFKAFGDDETAPDVKHCEQFKRGDKVRFVLGPFASFGGNILKLRKDRAVDGERVATGAVVAVDVFGKVSTIEAPLALLEQL GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 14->179|NUSG_RICTY|8e-13|31.8|154/192| BL:PDB:NREP 2 BL:PDB:REP 12->114|2k06A|7e-07|36.3|102/123| BL:PDB:REP 127->179|1nz9A|1e-04|40.0|45/58| RP:PDB:NREP 2 RP:PDB:REP 59->154|2ckkA|1e-08|8.0|88/120| RP:PDB:REP 125->188|2e70A|1e-04|14.8|54/71| RP:PFM:NREP 1 RP:PFM:REP 15->104|PF02357|9e-09|36.0|89/92|NusG| HM:PFM:NREP 1 HM:PFM:REP 14->104|PF02357|1.2e-19|40.4|89/92|NusG| GO:PFM:NREP 2 GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF02357|IPR006645| GO:PFM GO:0032968|"GO:positive regulation of RNA elongation from RNA polymerase II promoter"|PF02357|IPR006645| RP:SCP:NREP 2 RP:SCP:REP 12->119|1m1gA3|4e-14|18.0|100/101|d.58.42.1| RP:SCP:REP 126->188|1m1gA2|2e-06|27.3|55/58|b.34.5.4| HM:SCP:REP 12->117|1nz8A_|1.6e-18|36.2|105/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| HM:SCP:REP 123->188|1m1gA2|4.8e-05|24.1|58/58|b.34.5.4|1/1|Translation proteins SH3-like domain| OP:NHOMO 176 OP:NHOMOORG 175 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------1-11------------------------------------------------------------1----------------------------------------1-----------------------------------------1111------------------------------------------------------------------------------------------------------------1--------------------------1--1----1--1111--1--1111111111111----------1-11-11-1--11--11-------2-----1-11----------------11---11------------11--111111111----------------------------------------1-1--------11-111--------------------------11-1111--1111----11-1-11111--1----------------------------------------------------------------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111------------------------------------------------------------------------------------------------------11-------111--1--1--------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 90.4 SQ:SECSTR ###########ccEEEEEEEcTTcHHHHHHHHHHHTHHHHTcTTTcccccccccccTTcccccccTTcEEEEcccTTcGGGTTcEEEEEEEETTTEEEEETTTccEEEEEccccHHHHGGGEEEccccTTcEEEEcccTTTTcEEEEEEEEGGGT#######cEEEEEEcccccEEEEcTTTEEEccc DISOP:02AL 1-9,116-118| PSIPRED ccHHHHHcccccEEEEEEEEEcccHHHHHHHHHHcccEEEEcEEEEEEEEEEccEEEEEEEEEEccEEEEEEEEcHHHHHHHHccccEEEEEccccEEEEccHHHHHHHHHHHcccccccccccEEcccccEEEEEccccccccEEEEEEcccccccccccccEEEEEEEEccccEEEEEEHHHEEEc //