[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : omp
DDBJ      :omp          outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   104->209 1bxwA PDBj 2e-04 32.7 %
:RPS:PDB   39->209 1bxwA PDBj 3e-08 21.8 %
:RPS:SCOP  41->209 1bxwA  f.4.1.1 * 6e-12 20.9 %
:HMM:SCOP  38->209 1g90A_ f.4.1.1 * 2.6e-29 35.5 %
:RPS:PFM   71->209 PF01389 * OmpA_membrane 1e-07 38.7 %
:HMM:PFM   121->191 PF02530 * Porin_2 4.1e-08 25.5 55/402  
:HMM:PFM   47->105 PF04338 * DUF481 0.00044 16.4 55/210  
:BLT:SWISS 39->209 OM25_BRUSU 4e-27 35.9 %
:REPEAT 3|46->90|91->132|133->172
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87905.2 GT:GENE omp GT:PRODUCT outer membrane protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2127166..2127795 GB:FROM 2127166 GB:TO 2127795 GB:DIRECTION + GB:GENE omp GB:PRODUCT outer membrane protein GB:PROTEIN_ID AAK87905.2 GB:DB_XREF GI:159140353 GB:GENE:GENE omp LENGTH 209 SQ:AASEQ MKTLIVTSLLALSASTAMAADAVYETPAPPVAQETLPVFTWSGPYLGIQGGAGWANGDFSAGGPVVSDDFNGGILGAFAGYNYQFDNNMVLGIEGDVDYNWNDNDYSGIKVGTDWQGSVRGRVGYAFDHALIYATAGWTATRGFIETPVGDDKATFNGYTVGAGVDYAFTDNVFGRLEYRYNDYGDKDIFGINTDFDQHTVKVGLGVKF GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 39->209|OM25_BRUSU|4e-27|35.9|167/213| NREPEAT 1 REPEAT 3|46->90|91->132|133->172| SEG 8->22|sllalsastamaada| BL:PDB:NREP 1 BL:PDB:REP 104->209|1bxwA|2e-04|32.7|104/172| RP:PDB:NREP 1 RP:PDB:REP 39->209|1bxwA|3e-08|21.8|165/172| RP:PFM:NREP 1 RP:PFM:REP 71->209|PF01389|1e-07|38.7|137/188|OmpA_membrane| HM:PFM:NREP 2 HM:PFM:REP 121->191|PF02530|4.1e-08|25.5|55/402|Porin_2| HM:PFM:REP 47->105|PF04338|0.00044|16.4|55/210|DUF481| GO:PFM:NREP 2 GO:PFM GO:0009279|"GO:cell outer membrane"|PF01389|IPR000498| GO:PFM GO:0016021|"GO:integral to membrane"|PF01389|IPR000498| RP:SCP:NREP 1 RP:SCP:REP 41->209|1bxwA|6e-12|20.9|163/172|f.4.1.1| HM:SCP:REP 38->209|1g90A_|2.6e-29|35.5|166/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 263 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2434524BBE6657679755575775775-2111223947--43322224323257----11------1--------------1-------------------------------11----------------------------------------------------1-------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 80.4 SQ:SECSTR ######################################ccTTcEEEEEEEEEEcccccccccc###cccccccEEEEEEEEEEEEETTEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEccTTTccEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEccccccccccccccccEEEEEEEEEE PSIPRED cHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEEccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEccccccccccEEEEEEEEEEEEEEcccEEEEEEEEEEEcccccEEEEcccEEEEEEEEEEEEEc //