[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ordL.1
DDBJ      :ordL         oxidoreductase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  329/915 : Eukaryota  32/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:442 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->133 1reoA PDBj 5e-05 45.1 %
:BLT:PDB   132->398 1ryiA PDBj 1e-11 27.9 %
:RPS:PDB   18->65 1chuA PDBj 7e-04 12.5 %
:RPS:PDB   44->423 1b3mA PDBj 6e-37 15.6 %
:RPS:SCOP  44->313 1ng3A1  c.3.1.2 * 5e-29 16.6 %
:HMM:SCOP  44->348 1el5A1 c.3.1.2 * 4.1e-42 29.7 %
:RPS:PFM   46->397 PF01266 * DAO 7e-29 32.0 %
:HMM:PFM   46->395 PF01266 * DAO 1.4e-69 33.4 338/358  
:BLT:SWISS 38->442 PUUB_ECOLI e-126 51.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86013.1 GT:GENE ordL.1 GT:PRODUCT oxidoreductase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 198256..199584 GB:FROM 198256 GB:TO 199584 GB:DIRECTION + GB:GENE ordL GB:PRODUCT oxidoreductase GB:PROTEIN_ID AAK86013.1 GB:DB_XREF GI:15155080 GB:GENE:GENE ordL LENGTH 442 SQ:AASEQ MTPISGRCEMAEVTNIPNPGHTSSWYAASANVKSVRPTLEGALEADVCIIGGGFTGISAALELSERGYAVIVLEGVRVGFGASGRNGGQIVNGYSRDLETIARRYGHEKAVKLGEMSLEGGTIIRSRVAKYGIDCDLVDGGFFAAFTPKQIREMEAHKAHWEKHGHGGLEMVSEADVGQYVKTNRYAGGMIDRFGGHIHPLNLVQGEAAAAESLGARIFENSRVIAVEQGANPIVRTAMGSVKAKYVLVCGNAYLGTLLPEIGERMMPVSSQVMATEPLDADLIEALLPANYCVEDANYILDYYRRTSDNRLLYGGGIGYGGSDPADLTGVIRPNMLKTFPQLEKTKIEFAWSGNFALTLTRIPHMGRLSDNIYFSHGDSGHGVTTTHLLGKILGEAVAGHAERFDIWSSLPNYPFPGGKTFRVPLTMLGAWWYGLRDKLGL GT:EXON 1|1-442:0| BL:SWS:NREP 1 BL:SWS:REP 38->442|PUUB_ECOLI|e-126|51.9|405/426| SEG 314->322|ygggigygg| BL:PDB:NREP 2 BL:PDB:REP 47->133|1reoA|5e-05|45.1|71/484| BL:PDB:REP 132->398|1ryiA|1e-11|27.9|244/364| RP:PDB:NREP 2 RP:PDB:REP 18->65|1chuA|7e-04|12.5|48/478| RP:PDB:REP 44->423|1b3mA|6e-37|15.6|366/385| RP:PFM:NREP 1 RP:PFM:REP 46->397|PF01266|7e-29|32.0|341/354|DAO| HM:PFM:NREP 1 HM:PFM:REP 46->395|PF01266|1.4e-69|33.4|338/358|DAO| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01266|IPR006076| RP:SCP:NREP 1 RP:SCP:REP 44->313|1ng3A1|5e-29|16.6|259/276|c.3.1.2| HM:SCP:REP 44->348|1el5A1|4.1e-42|29.7|273/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 903 OP:NHOMOORG 364 OP:PATTERN ----------------------------------------------1----1---1------------ -1-22--1------2------2---2------22221-3311-1---1----1--1-----25---22122-----------1-------1--------1--------1---------------------------11122---14-------11------------------------------------11111111-12-112-----11-1112-1---1--------2---------------------------------------------------------------------------------------------------------11------1----1----11-1----------------211111111--3231113123122222222229---2--5-2362-77744583366732---2245435436--------111---12-----------------------------2-431--7642889B9B4111199B83333-3C79353---112111--114336-------111111111----1-21----1-----------------11-112-----------------------------32-1--41---5333323344434434344--------------1-1---111-1---11-11111--1111-111111-2221122-111111111111111121111111-----------------1------------45----11-111-1--132312-1-1-21AA8BAA9859B893434-------------------121112211111111-------------------------------------------------------------1- ------------11-312-1---23-1-------1-------------121242--4-1------------------------------1-111211-2----------1-----------------------------------------------------3-------------1-------1--22--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 425 STR:RPRED 96.2 SQ:SECSTR #################ccccTTccccccccTTccccccccccEEEEEEEcccHHHHHHHHHHHHTTccEEEEcccccccccccccccEEEEccccTTcTTHHHHHHHHHHHHHHHHHHcccccEEcHHHHcccccEEcccEEEEEETTccHHHHHHHHHHHHHTcccEETHHHHHHcTTccccTTEEEEEETTcEEEEHHHHHHHHHHHHHHTTcEEEccccEEEEcccTTcEEEETTEEEEEEEEEEccGGGHHHHGGGGTEEcEEEEEEEEEEcccHHHHcGGGTccEEEEEETTEEEEEEcccTTccEEEEEccccEEccTTTccccTTccHHHHcGGGcGccEEEEEEEEEEEcTTcccEEEEETEEEEEEEccTTccGGGHHHHHHHHHHHHHHcccccccGGGcTTHcGGGccEEccTTcccTTcccEGGGcccc DISOP:02AL 442-443| PSIPRED cccccccccccccccccccccccHHHHccccccccccccccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccEEEEEcHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHccccccEEEEEEccccEEcHHHHHHHHHHHHHHcccEEEcccEEEEEEEcccEEEEEccEEEEccEEEEcccHHHHHHHHHccccEEEEEEEEEEEEEccHHHHHHccccccEEEcccccEEEEEEcccccEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccc //