[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : parA.2
DDBJ      :parA         Chromosome partitioning protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  683/915 : Eukaryota  5/199 : Viruses  4/175   --->[See Alignment]
c.37.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->257 1wcv1 PDBj 2e-53 47.3 %
:RPS:PDB   5->259 2bekA PDBj 9e-36 41.6 %
:RPS:SCOP  8->258 1cp2A  c.37.1.10 * 9e-39 16.0 %
:HMM:SCOP  5->264 1ionA_ c.37.1.10 * 1.7e-67 36.4 %
:RPS:PFM   10->197 PF01656 * CbiA 1e-16 39.5 %
:HMM:PFM   9->226 PF01656 * CbiA 4.3e-45 37.6 186/194  
:BLT:SWISS 7->263 PARA_CAUCR 3e-89 59.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88540.1 GT:GENE parA.2 GT:PRODUCT Chromosome partitioning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2833540..2834334) GB:FROM 2833540 GB:TO 2834334 GB:DIRECTION - GB:GENE parA GB:PRODUCT Chromosome partitioning protein GB:PROTEIN_ID AAK88540.1 GB:DB_XREF GI:15158059 GB:GENE:GENE parA LENGTH 264 SQ:AASEQ MTFEKNRIIAVANQKGGVGKTTTAINLATALAAIGERVLIIDLDPQGNASTGLGIDRKERKLSSYDLLVGEHGIAEVAVPTAVPNLDIVPSTMDLLGFEMQVANVANRVFLLRAAMETPEARGYSYILVDCPPSFNLLTMNAMTAAHSVLVPLQCEFFALEGLSQLLDTVSQIRGSVNPQLDIQGIVLTMFDARNNLAQQVVSDVRSHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGSQAYLQLASEVIQRERLRKAA GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 7->263|PARA_CAUCR|3e-89|59.9|257/267| SEG 21->34|tttainlatalaai| BL:PDB:NREP 1 BL:PDB:REP 5->257|1wcv1|2e-53|47.3|239/243| RP:PDB:NREP 1 RP:PDB:REP 5->259|2bekA|9e-36|41.6|243/244| RP:PFM:NREP 1 RP:PFM:REP 10->197|PF01656|1e-16|39.5|162/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 9->226|PF01656|4.3e-45|37.6|186/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 8->258|1cp2A|9e-39|16.0|244/269|c.37.1.10| HM:SCP:REP 5->264|1ionA_|1.7e-67|36.4|242/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1401 OP:NHOMOORG 722 OP:PATTERN --------111111-1--------486-3-3-111-1------11-11---1--11112221-1---- 2111222222222243335-342243333333333425662343423223334342223322323332422222222211311--1--222412111--111111212312122111112111122211222221432233---224243111-1--------211-5732------------4342211121112122112111111111111122322111--211111113------------------15111111-11111111112-231-1------1------------------------1---------1---122111111111213221112111211212211111223121111111--222211211111-11124121212122222222225-233115125311444795496654121113224123221222222222112132211-11111--1111111131111111-111131111111132222221111332311111123212321111121121111321223121222121111122142134441322262332511111122334334411111111111111111111111111111241253222412232222222222322222---2443---------1-1--11----11--1---1-----11-------111----1-----1--------------------111111-1111----122212211124422---------------22223221112233333334344443333---------13345222224323322223222222111--113344446954115111----------1-1------11---------1-----131 -----------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------1-----------------3--------1- ----------------------1--------------------------------------------------------------------------------------------1---1--------------------------1---------------------------- STR:NPRED 263 STR:RPRED 99.6 SQ:SECSTR TTcccccEEEEccccTTccHHHHHHHHHHHHHTTTccEEEEEccTTcHHHHTTTccccccHHHHHTTccGGGTcTcEEEcEEETTEEEEcccTTHHHHHHHTTTcTTHHHHHcccTTHHHHHHccEEEEEccccccHHHHHHHHHccEEEEEEEccHHHHHHHHHHHHHHHHHHHTTcTTcEEEEEEEEcccTTcHHHHHHHHHHHHHHGGGcccccccccHHHHHGGGGTccHHHHcTTcHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 1-4, 262-264| PSIPRED ccccccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHccccccccccHHHHHcccccHHHHHEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcEEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccHHHHHHHHHHHHccccEEEccccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHccc //