[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pcm.1
DDBJ      :pcm          protein-L-isoaspartate O-methyltransferase
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  435/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->205 2yxeB PDBj 6e-20 31.3 %
:RPS:PDB   8->173 1cmvB PDBj 4e-17 10.7 %
:RPS:SCOP  8->205 1i1nA  c.66.1.7 * 5e-31 27.8 %
:HMM:SCOP  4->212 1jg1A_ c.66.1.7 * 2.1e-35 24.4 %
:RPS:PFM   10->206 PF01135 * PCMT 2e-30 40.0 %
:HMM:PFM   9->208 PF01135 * PCMT 2.6e-41 32.2 199/210  
:BLT:SWISS 10->213 PIMT_RHIME 2e-65 54.9 %
:PROS 131->146|PS01279|PCMT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87474.2 GT:GENE pcm.1 GT:PRODUCT protein-L-isoaspartate O-methyltransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1686722..1687363) GB:FROM 1686722 GB:TO 1687363 GB:DIRECTION - GB:GENE pcm GB:PRODUCT protein-L-isoaspartate O-methyltransferase GB:PROTEIN_ID AAK87474.2 GB:DB_XREF GI:159140157 GB:GENE:GENE pcm LENGTH 213 SQ:AASEQ MVEKEGFAALVLRLRGEGISDLDLLTAVEQTPRSKFVPPQFAADAYSSRTIPIDCGSFMEGADMAVKILARLQLKPGQRVLEIGTGSGFMTAIIARRVERVFSLERYKTLVQQAQNCLDDLSIRNVVIRQADGSNGLVGEGTFDRIVSTAAFTTMPRFFAEQIVSGGMMIAPIILEDERCVMTRFSKTGSRFEKEELFETPYLPLGSHIARHL GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 10->213|PIMT_RHIME|2e-65|54.9|204/204| PROS 131->146|PS01279|PCMT|PDOC00985| BL:PDB:NREP 1 BL:PDB:REP 9->205|2yxeB|6e-20|31.3|195/213| RP:PDB:NREP 1 RP:PDB:REP 8->173|1cmvB|4e-17|10.7|159/206| RP:PFM:NREP 1 RP:PFM:REP 10->206|PF01135|2e-30|40.0|195/205|PCMT| HM:PFM:NREP 1 HM:PFM:REP 9->208|PF01135|2.6e-41|32.2|199/210|PCMT| GO:PFM:NREP 2 GO:PFM GO:0004719|"GO:protein-L-isoaspartate (D-aspartate) O-methyltransferase activity"|PF01135|IPR000682| GO:PFM GO:0006464|"GO:protein modification process"|PF01135|IPR000682| RP:SCP:NREP 1 RP:SCP:REP 8->205|1i1nA|5e-31|27.8|194/225|c.66.1.7| HM:SCP:REP 4->212|1jg1A_|2.1e-35|24.4|209/0|c.66.1.7|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 690 OP:NHOMOORG 513 OP:PATTERN 1111111111111111-11111121--1-111--11111111111-111121111111111---1--- -1--2------------------------------------113--------------------12-111------------1-------------1--11111211-21--------------111-11111111---11---1--------11--------1--1---------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------111111131221213112112212111111111112-33133331232-111222423223112221111111121-------------122-----------------------------------22222122221211113331111122224323211222222222242222242222221111111223222121112111111111222111312-1211-13-111111111111111111111112221111311111-1111111111111111121---3223------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111131111-------------------------1111111111111111111---------31111111111111122222222222222111---1111------------------------------------111-1-1----1- -----------------------------------------------------------------------------------------1-1-111-----------------------------------------------------------111---------11--121--------11-612--2---4233- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 99.5 SQ:SECSTR #ccHHHHHHTTcccEEEETEEEEEEEEEEEcccEEEEEEEEccHHHHHHHHHHHHTcHHHcHHHHHHHTcccTTccccHHHHHHHHHccEEEEcccEEEcTTcccEEEccHHHHHTTcTTccHHHHHHHHHHHHccccccccHHHHHHHHHHHHTcTTHHHHHHHHHHHHTcccHHHHHcEEEEEEEETTEEEEEEEEEcccccccGGGccHH DISOP:02AL 1-3,211-211,213-214| PSIPRED cccHHHHHHHHHHHHHcccccHHHHHHHHHccHHHcccHHHHHccccccccccccccEEccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHcccccccccEEEEEccHHHHHHHHHHHHccccEEEEEEcccccEEEEEEEEEEccEEEEEEEEEEEEEEcHHHHHHHc //