[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pdxJ
DDBJ      :pdxJ         pyridoxal phosphate biosynthesis protein
Swiss-Prot:PDXJ_AGRT5   RecName: Full=Pyridoxine 5'-phosphate synthase;         Short=PNP synthase;         EC=2.6.99.2;

Homologs  Archaea  0/68 : Bacteria  507/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.24
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->239 1m5wA PDBj 4e-38 40.3 %
:RPS:SCOP  4->242 1ho1A  c.1.24.1 * 5e-75 39.5 %
:HMM:SCOP  1->251 1ho1A_ c.1.24.1 * 1e-73 42.1 %
:RPS:PFM   5->240 PF03740 * PdxJ 2e-48 45.6 %
:HMM:PFM   4->246 PF03740 * PdxJ 2.6e-81 43.4 235/239  
:BLT:SWISS 1->251 PDXJ_AGRT5 e-147 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87778.2 GT:GENE pdxJ GT:PRODUCT pyridoxal phosphate biosynthesis protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1985658..1986413) GB:FROM 1985658 GB:TO 1986413 GB:DIRECTION - GB:GENE pdxJ GB:PRODUCT pyridoxal phosphate biosynthesis protein GB:PROTEIN_ID AAK87778.2 GB:DB_XREF GI:159140289 GB:GENE:GENE pdxJ LENGTH 251 SQ:AASEQ MPAKLSVNLNAIAMLRNRRDLPWPDVAHFGQIALSAGASGLTVHPRPDQRHIRFSDLPVLRALIDDRFPGAEFNIEGYPTEDFLVLCEKTQPEQVTLVPDDPSQATSDHGWDFRKHAVFLKDVVGRLKAGGMRVSLFADGDGEREPVELAAETGAARIELYTGPYGGCFDDTQKADLLVEKLGQTADHAAALGLAVNAGHDLTVANLPKLMKRIPNLAEVSIGHGLTADAMEYGMAETVRRFCQACGQRNS GT:EXON 1|1-251:0| SW:ID PDXJ_AGRT5 SW:DE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase; EC=2.6.99.2; SW:GN Name=pdxJ; OrderedLocusNames=Atu2024; ORFNames=AGR_C_3668; SW:KW Complete proteome; Cytoplasm; Pyridoxine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->251|PDXJ_AGRT5|e-147|100.0|251/251| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008615|"GO:pyridoxine biosynthetic process"|Pyridoxine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 5->239|1m5wA|4e-38|40.3|226/242| RP:PFM:NREP 1 RP:PFM:REP 5->240|PF03740|2e-48|45.6|228/237|PdxJ| HM:PFM:NREP 1 HM:PFM:REP 4->246|PF03740|2.6e-81|43.4|235/239|PdxJ| GO:PFM:NREP 2 GO:PFM GO:0005737|"GO:cytoplasm"|PF03740|IPR004569| GO:PFM GO:0008615|"GO:pyridoxine biosynthetic process"|PF03740|IPR004569| RP:SCP:NREP 1 RP:SCP:REP 4->242|1ho1A|5e-75|39.5|223/235|c.1.24.1| HM:SCP:REP 1->251|1ho1A_|1e-73|42.1|242/0|c.1.24.1|1/1|Pyridoxine 5'-phosphate synthase| OP:NHOMO 512 OP:NHOMOORG 509 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------111111111-111---11111111111---------------11111111111----------1111111111111111111111111111111111111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111-11111111111111111111111111111111-1--11111111111111111111111111111---------------1-11111111111111112111111111111111111111111-1111111111111111111211111111111111111111111-1-11111-111111111111111111--11111111-1111111111111111111111111111111111111111111111--1111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------11111111111111111111111111111---------11111111111111111111111111111111-111111----------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 92.0 SQ:SECSTR ####EEEEcHHHHHHHHTcccccccHHHHHHHHHTTTccEEEEEccTTcccccHHHHHHHHHHcccE#####EEEEEcccHHHHHHHHHHcccEEEEccccccccccccccccGGGHHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHTTccEEEEEcHHHHHcccHHHHHHHHHHHHHHHHHHHHHTTcEEEEEccccTTTHHHHHHTcTTEEEEEEcHHHHHHHHHHcHHHHHH########### DISOP:02AL 249-252| PSIPRED ccEEEEccHHHHHHHHHccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHccccEEEEccccHHHccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //