[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pecM
DDBJ      :pecM         regulator protein pecM
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  97/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:287 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  187->284 1s7bA  f.39.1.1 * 1e-05 16.3 %
:HMM:SCOP  43->145 1s7bA_ f.39.1.1 * 9.7e-08 31.1 %
:HMM:SCOP  181->289 1s7bA_ f.39.1.1 * 1.9e-13 35.2 %
:RPS:PFM   173->279 PF00892 * EamA 5e-05 31.8 %
:HMM:PFM   20->137 PF00892 * EamA 7.9e-13 26.3 118/126  
:HMM:PFM   157->280 PF00892 * EamA 6.2e-24 34.1 123/126  
:BLT:SWISS 17->236 PECM_DICD3 9e-32 38.4 %
:BLT:SWISS 209->280 EAMA_SALTY 1e-05 27.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86089.1 GT:GENE pecM GT:PRODUCT regulator protein pecM GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 269293..270156 GB:FROM 269293 GB:TO 270156 GB:DIRECTION + GB:GENE pecM GB:PRODUCT regulator protein pecM GB:PROTEIN_ID AAK86089.1 GB:DB_XREF GI:15155168 GB:GENE:GENE pecM LENGTH 287 SQ:AASEQ MKKNMTYAADVLVTALAPAIWGTTYFVTTEFLPQGYPLHVAMLRALPAGILLLLLVRKLPQGIWWPRSFILGALNFSFFWAMLFVSAYRLPGGVAATVGAVQPLIVIGLSRLFLSTPVRPLAIGAGFLGIAGVALLVLTPGAALDGIGVAAGLAGAVSMAFGTVLTRKWRPPVSNLTFTAWQLTAGGILLLPVAYALEPALPAPTAVNVMGMAYLGLIGAALTYLLWFRGLARIEPSAAASLGFLSPVVATLLGWLALGQSLAPAQIAGFIAVLFSIWLSQRSQLPR GT:EXON 1|1-287:0| BL:SWS:NREP 2 BL:SWS:REP 17->236|PECM_DICD3|9e-32|38.4|219/297| BL:SWS:REP 209->280|EAMA_SALTY|1e-05|27.8|72/299| TM:NTM 9 TM:REGION 5->27| TM:REGION 35->56| TM:REGION 67->89| TM:REGION 92->114| TM:REGION 118->140| TM:REGION 145->166| TM:REGION 180->202| TM:REGION 206->228| TM:REGION 249->271| SEG 51->55|lllll| SEG 121->138|laigagflgiagvallvl| SEG 141->157|gaaldgigvaaglagav| RP:PFM:NREP 1 RP:PFM:REP 173->279|PF00892|5e-05|31.8|107/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 20->137|PF00892|7.9e-13|26.3|118/126|EamA| HM:PFM:REP 157->280|PF00892|6.2e-24|34.1|123/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 1 RP:SCP:REP 187->284|1s7bA|1e-05|16.3|98/106|f.39.1.1| HM:SCP:REP 43->145|1s7bA_|9.7e-08|31.1|103/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 181->289|1s7bA_|1.9e-13|35.2|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 121 OP:NHOMOORG 105 OP:PATTERN ---------------------------1-1-------------------------------------- ----11-1---2------------------------1--------1------1---------2-1-1211--------------------------------------------------------------------------1-1----------1------------1------------------------------1------1--11------------------1----------------------------1-------------------------------------------------------------------------------------------------1-----------------------------111--11-11------------------------11111111-1211------1-----11----------------------------------------------------1112------------------------1-1---1-------1------------1-----------1-------------22-----------1--1------------------------------------------111111--111--1-11-----------------12------------------1--------------11111--------1---------1-----------11111111111---------------1-----------------1---1----------------------1-------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-19----11--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 286-287| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc //