[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pemI
DDBJ      :pemI         PemI protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->49 1ektA PDBj 6e-07 22.4 %
:RPS:SCOP  5->66 1ub4C  b.129.1.1 * 1e-07 31.1 %
:HMM:SCOP  3->78 1ub4C_ b.129.1.1 * 8.3e-09 32.0 %
:HMM:PFM   14->52 PF04014 * SpoVT_AbrB 9.7e-09 25.6 39/47  
:BLT:SWISS 4->88 PEMI_ECOLX 2e-14 39.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86745.2 GT:GENE pemI GT:PRODUCT PemI protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 928967..929233 GB:FROM 928967 GB:TO 929233 GB:DIRECTION + GB:GENE pemI GB:PRODUCT PemI protein GB:PROTEIN_ID AAK86745.2 GB:DB_XREF GI:159139846 GB:GENE:GENE pemI LENGTH 88 SQ:AASEQ MTVTTKIRRQGGAAVMTIPPALLKMLGLEIGEQLTLEVDNGALVASPVRLEKKRFTLAELLDGAEEVAALNARERAWDTAPPVGKEAL GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 4->88|PEMI_ECOLX|2e-14|39.8|83/85| RP:PDB:NREP 1 RP:PDB:REP 1->49|1ektA|6e-07|22.4|49/53| HM:PFM:NREP 1 HM:PFM:REP 14->52|PF04014|9.7e-09|25.6|39/47|SpoVT_AbrB| RP:SCP:NREP 1 RP:SCP:REP 5->66|1ub4C|1e-07|31.1|61/75|b.129.1.1| HM:SCP:REP 3->78|1ub4C_|8.3e-09|32.0|75/0|b.129.1.1|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1------112-------------------------------1-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1-----------------------------------------------1---------------1----1--1-----------------------------------------------------------------1----------------------------------------------------------1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 55.7 SQ:SECSTR cccccEEEcccTTccccccHHHHHHHcccccccEEEEEETTEEEEEEcc####################################### DISOP:02AL 1-3,87-89| PSIPRED ccEEEEEEEEccEEHHHHHHHHHHHcccccccEEEEEEEccEEEEEEcccccccccHHHHHccccccccccccccccccccHHHHHcc //