[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : pemK
DDBJ      :pemK         PemK protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.34.6
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->116 2c06A PDBj 3e-12 33.3 %
:RPS:PDB   8->116 2c06A PDBj 1e-17 40.0 %
:RPS:SCOP  8->116 1m1fA  b.34.6.2 * 6e-19 39.2 %
:HMM:SCOP  2->117 1ub4A_ b.34.6.2 * 2.8e-23 33.0 %
:RPS:PFM   9->108 PF02452 * PemK 2e-06 35.9 %
:HMM:PFM   8->115 PF02452 * PemK 3.4e-24 30.4 102/110  
:BLT:SWISS 1->117 CHPB_ECOLI 1e-12 37.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86746.2 GT:GENE pemK GT:PRODUCT PemK protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 929233..929592 GB:FROM 929233 GB:TO 929592 GB:DIRECTION + GB:GENE pemK GB:PRODUCT PemK protein GB:PROTEIN_ID AAK86746.2 GB:DB_XREF GI:159139847 GB:GENE:GENE pemK LENGTH 119 SQ:AASEQ MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQVRSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|CHPB_ECOLI|1e-12|37.2|113/116| BL:PDB:NREP 1 BL:PDB:REP 8->116|2c06A|3e-12|33.3|105/110| RP:PDB:NREP 1 RP:PDB:REP 8->116|2c06A|1e-17|40.0|105/110| RP:PFM:NREP 1 RP:PFM:REP 9->108|PF02452|2e-06|35.9|92/108|PemK| HM:PFM:NREP 1 HM:PFM:REP 8->115|PF02452|3.4e-24|30.4|102/110|PemK| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF02452|IPR003477| RP:SCP:NREP 1 RP:SCP:REP 8->116|1m1fA|6e-19|39.2|102/107|b.34.6.2| HM:SCP:REP 2->117|1ub4A_|2.8e-23|33.0|109/0|b.34.6.2|1/1|Cell growth inhibitor/plasmid maintenance toxic component| OP:NHOMO 58 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------1------112-------------------------------1-----------------------------------------------------1----22---------1-------1------------1-----------11121---------------1---------1------------1----------------------------------------------------------------------------111-1---11-1-112--1111----1----1-1-1---1-----------------11-1-----------------1--------------------------1------------------------1--1---1--------------------------1---------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 96.6 SQ:SECSTR #cccccccTTEEEEEcccccccccccccEEEEEcccHHHHHHccccEEcEEcccccccccTTcccccccccccEEcccccccccccccccEEccEEEEEccHHHHHHHTTTcGGGc### DISOP:02AL 1-2| PSIPRED ccccccccccEEEEEEcccccccccccccEEEEEccccccccccEEEEEEcccccccccccEEEEEccccccEEEEEEEEEEEEHHHHHHccccEEEccccHHHHHHHHHHHHHHcccc //