[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phaC
DDBJ      :phaC         pH adaption potassium efflux system protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->106 PF00420 * Oxidored_q2 1.4e-23 43.0 86/95  
:BLT:SWISS 1->111 PHAC_RHIME 2e-34 64.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86325.1 GT:GENE phaC GT:PRODUCT pH adaption potassium efflux system protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(499889..500224) GB:FROM 499889 GB:TO 500224 GB:DIRECTION - GB:GENE phaC GB:PRODUCT pH adaption potassium efflux system protein GB:PROTEIN_ID AAK86325.1 GB:DB_XREF GI:15155443 GB:GENE:GENE phaC LENGTH 111 SQ:AASEQ MELILAIGIGIMTGSGVWLILRPRTYQVIVGLSLLSYAVNLFIFGVGGIKTNAPPVLVNGVDSSTLADPVPQALVLTAIVIGFATTALFLVVLLAARGLTGTDHVDGRESK GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 1->111|PHAC_RHIME|2e-34|64.0|111/115| TM:NTM 3 TM:REGION 1->22| TM:REGION 27->49| TM:REGION 75->97| SEG 83->96|fattalflvvllaa| HM:PFM:NREP 1 HM:PFM:REP 5->106|PF00420|1.4e-23|43.0|86/95|Oxidored_q2| OP:NHOMO 160 OP:NHOMOORG 152 OP:PATTERN ------------------------------------------------------------1------- ------------1-1---------------------11----------------------------------------------------------------------1----------------1--1-11---1111----------------------------------------------------------------------1-111-------11111----------------------1---1------------------------------------------------------------------------------------------------------------------------------111111-----1111111111111111111-11-11-1-----1221-1111111-----1122222111---------------------------------------------------11111------------------------111--------11111--1111111-----------1111--------1---------------------11---------------------------------1-11-11-----------------------111-------------------------------------------------------------------------------------------------------1111---------------1111111---1111111111111112111---------1--------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 100-111| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //