[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phaE
DDBJ      :phaE         phaE protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  145/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   60->154 PF01899 * MNHE 5e-11 37.2 %
:HMM:PFM   60->160 PF01899 * MNHE 3.3e-09 27.6 98/106  
:HMM:PFM   9->90 PF01957 * NfeD 0.00012 20.0 80/144  
:BLT:SWISS 27->161 PHAE_RHIME 2e-22 38.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86323.2 GT:GENE phaE GT:PRODUCT phaE protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(497761..498246) GB:FROM 497761 GB:TO 498246 GB:DIRECTION - GB:GENE phaE GB:PRODUCT phaE protein GB:PROTEIN_ID AAK86323.2 GB:DB_XREF GI:159139664 GB:GENE:GENE phaE LENGTH 161 SQ:AASEQ MSRLLPYPLLTVSLIFFWLTINSFSAGHLLLGTGVALIASWAMASLRPAKPRIRNWHRLVQLILIVLYDIVRSNLSVAKIILFQRERDRKSGFLAVPLEIRDPMALAVLATILTSTPGSAWLEYNSSQGTLLLHVLDDVDEAAWISLIKNRYEKLLMEIFE GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 27->161|PHAE_RHIME|2e-22|38.8|134/161| TM:NTM 3 TM:REGION 16->38| TM:REGION 60->82| TM:REGION 104->125| RP:PFM:NREP 1 RP:PFM:REP 60->154|PF01899|5e-11|37.2|94/106|MNHE| HM:PFM:NREP 2 HM:PFM:REP 60->160|PF01899|3.3e-09|27.6|98/106|MNHE| HM:PFM:REP 9->90|PF01957|0.00012|20.0|80/144|NfeD| GO:PFM:NREP 3 GO:PFM GO:0006812|"GO:cation transport"|PF01899|IPR002758| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF01899|IPR002758| GO:PFM GO:0016021|"GO:integral to membrane"|PF01899|IPR002758| OP:NHOMO 150 OP:NHOMOORG 145 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1--------------------------------111-1---------------------------------------------------1-----------------1--1--------------------111111-1111111----1------------------------------------------------------------------------------------------------------------------------------111111-----1111111111111111111-11-11-1-1----111--1---11-----1122222111---------------------------------------------------11111------------------------11---------11111--1111111-----------1111--------1----------------------1---------------------------------1-11-11-----------------------------------------------------------------------------------------------------------------------11111-----1111---------------1111111---1111111111111111111---------1--------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcc //