[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phaG
DDBJ      :phaG         potassium efflux system protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->98 PF03334 * PhaG_MnhG_YufB 1e-07 34.2 %
:HMM:PFM   18->99 PF03334 * PhaG_MnhG_YufB 4.9e-24 35.0 80/81  
:HMM:PFM   6->23 PF10031 * DUF2273 0.00042 33.3 18/51  
:BLT:SWISS 1->106 PHAG_RHIME 3e-19 41.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86321.1 GT:GENE phaG GT:PRODUCT potassium efflux system protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(497142..497486) GB:FROM 497142 GB:TO 497486 GB:DIRECTION - GB:GENE phaG GB:PRODUCT potassium efflux system protein GB:PROTEIN_ID AAK86321.1 GB:DB_XREF GI:15155439 GB:GENE:GENE phaG LENGTH 114 SQ:AASEQ MNNAAEFPLWAAILVAFFVLLGASLTLTGTIGFAKLNSFYERLHAPTLGTSWGTGGIVMASIIYFSVSGDRFAFHEIFIGIFMTVTTPVSLMLLGRAALYRDRAEQNSDNREHL GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 1->106|PHAG_RHIME|3e-19|41.5|106/121| TM:NTM 3 TM:REGION 8->30| TM:REGION 46->68| TM:REGION 75->97| RP:PFM:NREP 1 RP:PFM:REP 18->98|PF03334|1e-07|34.2|79/81|PhaG_MnhG_YufB| HM:PFM:NREP 2 HM:PFM:REP 18->99|PF03334|4.9e-24|35.0|80/81|PhaG_MnhG_YufB| HM:PFM:REP 6->23|PF10031|0.00042|33.3|18/51|DUF2273| GO:PFM:NREP 3 GO:PFM GO:0005451|"GO:monovalent cation:hydrogen antiporter activity"|PF03334|IPR005133| GO:PFM GO:0015672|"GO:monovalent inorganic cation transport"|PF03334|IPR005133| GO:PFM GO:0015992|"GO:proton transport"|PF03334|IPR005133| OP:NHOMO 90 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-----1111111111111111111--------------111--1---11-----11121221-----------------------------------------------------1---1-------------------------11--------1111---1111-11-----------11----------1-----------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------1111---------------1111111-----11111-1-111--1111---------1----------------1-1--111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 102-114| PSIPRED cccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //