[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnC
DDBJ      :phnC         ABC transporter, nucleotide binding/ATPase protein (phosphonate)
Swiss-Prot:PHNC_AGRT5   RecName: Full=Phosphonates import ATP-binding protein phnC;         EC=3.6.3.28;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:286 amino acids
:PSIPRED
:BLT:PDB   5->233 3dhwC PDBj 3e-37 39.7 %
:RPS:PDB   3->233 3dmdC PDBj 3e-44 9.4 %
:RPS:SCOP  5->233 1b0uA  c.37.1.12 * 2e-42 33.9 %
:HMM:SCOP  5->228 1ii8.1 c.37.1.12 * 1.3e-63 34.8 %
:RPS:PFM   42->172 PF00005 * ABC_tran 3e-16 43.0 %
:HMM:PFM   42->173 PF00005 * ABC_tran 9e-28 33.6 116/118  
:HMM:PFM   12->56 PF03193 * DUF258 1.1e-05 18.2 44/161  
:BLT:SWISS 1->286 PHNC_AGRT5 e-160 100.0 %
:PROS 146->160|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85994.2 GT:GENE phnC GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (phosphonate) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(178483..179343) GB:FROM 178483 GB:TO 179343 GB:DIRECTION - GB:GENE phnC GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (phosphonate) GB:PROTEIN_ID AAK85994.2 GB:DB_XREF GI:159139527 GB:GENE:GENE phnC LENGTH 286 SQ:AASEQ MSFHLKQVTRRFGKHTAVDSVDVEIPQGQMVGVIGRSGAGKSTLLRMINRLVDPSSGSIHFNDTEVSSLKGAALRAWQRDCAMIFQQFNLVPRLDVLTNVMLGRLNHRSTALSLFNIFSHEERLMAIAALERLGIEHVAMQAAGTLSGGQQQRVAIARALMQSPKMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIIGMSQGRVVFDGTPAELTAAAVTEIYGTDSQGSGIDETMTSTSINIPGAQLAARPVQQSAGPEPLALAGL GT:EXON 1|1-286:0| SW:ID PHNC_AGRT5 SW:DE RecName: Full=Phosphonates import ATP-binding protein phnC; EC=3.6.3.28; SW:GN Name=phnC; OrderedLocusNames=Atu0174; ORFNames=AGR_C_290; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nucleotide-binding; Phosphonate transport;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|PHNC_AGRT5|e-160|100.0|286/286| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015716|"GO:phosphonate transport"|Phosphonate transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 146->160|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 5->233|3dhwC|3e-37|39.7|219/343| RP:PDB:NREP 1 RP:PDB:REP 3->233|3dmdC|3e-44|9.4|203/318| RP:PFM:NREP 1 RP:PFM:REP 42->172|PF00005|3e-16|43.0|121/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->173|PF00005|9e-28|33.6|116/118|ABC_tran| HM:PFM:REP 12->56|PF03193|1.1e-05|18.2|44/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 5->233|1b0uA|2e-42|33.9|221/258|c.37.1.12| HM:SCP:REP 5->228|1ii8.1|1.3e-63|34.8|221/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 50715 OP:NHOMOORG 1173 OP:PATTERN PPH9LJHIVUTQTQZNlJPOJPOXwOTgoRfRG9DCECGGGDCTYQXmMR**d8QYOPTLRHJFY199 VaoR*cgdoorVaNWSUNN-NgAAY*NNNNNNtoopw***X*Z*y**iwohN**zOVoDExz*l*q****ebccc*cbaQ*imCACACWWQN6QHLJ--EFRLLMgKZMU9AAAAAA9DBBBBBIURMSXPOWUZQnqr**MLL*Zzho*dckdiWXPIOINHhibo***XKSIKLKKSILJJpffTOsiBWez************************io***nrzy*wvu**XklklkhfiikkkihabXYb*ecY**ZPbXj*zQR**gXSYkiijlqquwqnwsttszuuonuzquudcdcbddegfeccxrmhggrqslo***********g*kr***Xihg*qjxs*llRN**soabgjRZkcihOeccNbXUUKLMLKNgY***fVv****************-ow*qj*p***UB**************JMN**********WVWWWWWW*hkJSla*44555444556888AB79A97888A7595LFEDDF***************y********l********BN**w*nzqu******cqoMZKSqYIJIIKIJQPRdtmZ**ShW*tYqvfeqKdbaXTahUZbdbbu*a*JJLRGNMMOLHCDDEEDEDCIVFFIONtrvSxRgKWO*SWZaXOWeXUUUVWeXWcc6-CKXSN321333*y**X*z**********-*************xy*zxv*****rqhpqlnnppoppmnpnnl*uorvvuxY3************44KIDFCDEOPQPRL*q*bZbbaZMQSOMWQUhNPRRPHSJPVzd********x****n***FEDBCGDCEMkrq*vvwwv*****TTSPOQOMNNFEEE75MVLLJJHI99897999*BbEDCDC-EEECJGCPOMCEMCHE88AYhqSRk*ioiFfP 2266dZN-eNACQXVIDKFFJMIWJTJFFBCCCKJICIFGFFFCCCJHIQQMcQJIODDDDEB8D7961694BB86726868878B45-NRADIIE98ACA8GIEE4Quc*WcYqeaKHECJVLxmBxE**l2pVyJKMEdGLgXFQLDDcCB*GYRQuKk*MvQZE*el*qkqTAIGF*BEBHNxil*F*tMJ*gqqQ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHccccccccccccEEcccccccccEEEcccccccEEccc //