[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnD
DDBJ      :phnD         ABC transporter, substrate binding protein (phosphonate)
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  227/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:301 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   116->186 1ovtA PDBj 3e-04 37.1 %
:RPS:PDB   22->244 1aivA PDBj 2e-32 22.5 %
:RPS:SCOP  52->197 1us4A  c.94.1.1 * 6e-11 19.1 %
:HMM:SCOP  38->252 1dotA2 c.94.1.2 * 1.1e-47 35.3 %
:RPS:PFM   87->151 PF09084 * NMT1 3e-06 47.6 %
:HMM:PFM   118->143 PF09084 * NMT1 3.3e-06 46.2 26/216  
:BLT:SWISS 25->263 PHND_ECOLI 4e-26 32.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85993.1 GT:GENE phnD GT:PRODUCT ABC transporter, substrate binding protein (phosphonate) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(177492..178397) GB:FROM 177492 GB:TO 178397 GB:DIRECTION - GB:GENE phnD GB:PRODUCT ABC transporter, substrate binding protein (phosphonate) GB:PROTEIN_ID AAK85993.1 GB:DB_XREF GI:15155056 GB:GENE:GENE phnD LENGTH 301 SQ:AASEQ MLKKVLLSAVALGVLAGSAMAQDVKVLRIGLDGSENEADQIRNTKCVADGLKAATGVSEVQVFPSPDYNGVIQGLLGGTIDIASMGASSYAKIALADPKAVDPILTTAGADGSTGYYTIMVARKDSGIKTLADAKGKKIGFADPDSTSGFLVPNVAIPKETGVPVKEYFSETGFGGGHENLVLAVLDKKFDVGTTFGSGVGKWEEGYTAGNLYQMVKKGNLDMDDIVQVWKSPLIPNGPLMVTNKLGDAMKQKVEDFFMELPKKDLACFQGFTQGKNTAYIKVDPSFYQTIIDARKSVIGG GT:EXON 1|1-301:0| BL:SWS:NREP 1 BL:SWS:REP 25->263|PHND_ECOLI|4e-26|32.9|222/338| TM:NTM 1 TM:REGION 5->27| SEG 1->21|mlkkvllsavalgvlagsama| BL:PDB:NREP 1 BL:PDB:REP 116->186|1ovtA|3e-04|37.1|70/682| RP:PDB:NREP 1 RP:PDB:REP 22->244|1aivA|2e-32|22.5|218/686| RP:PFM:NREP 1 RP:PFM:REP 87->151|PF09084|3e-06|47.6|63/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 118->143|PF09084|3.3e-06|46.2|26/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 52->197|1us4A|6e-11|19.1|141/298|c.94.1.1| HM:SCP:REP 38->252|1dotA2|1.1e-47|35.3|207/0|c.94.1.2|1/1|Periplasmic binding protein-like II| OP:NHOMO 292 OP:NHOMOORG 230 OP:PATTERN ------------------------2------1------------------------------------ ----------1--------------1------1-1-1--1--1------1--1-------------1--------1----1-------------------------------------------------------1----------1--11--4-------12---1433------11---------------111111111111111-3----111----1---------2----------------1121-1-------1-11----------------------------------------------------------3----------1-1----1----1------1--------1-------1---------------114--112111----------1--11-21-2-1--211111111111121111-1-2--221-----------------------------------------------1----1111--------111--1111111---11122------2-133-11113211-----------------12-----32---112-------1-------------------------------1-----11--8-----11-----1------------------1------1-11-1-1111111111-111111111111111111-111-1----1--------------11111111--111111111111----------------21---------------------------22222-11113111222---------1-----------1------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 92.0 SQ:SECSTR #####################HHHHTcTTcccccccccccccHHHHHHHHHHcTTTTHTcccEEEccTTHHHHHHHTTcccccEEcHHHHHHHHHHTcEEEcGGGcccccccccccEEEEEEEcccccccTTccTTcEEEEcccccTTTTHHHHHHHHTTcccccTTTccEEEcTTccTTccTTTTccccccccccccccccTTcccHHHHHHHHHHTccEEEEEGGGTTTTTTTTcccTTTTTccGGGEEEEcTTccEEETTcccccccEGHHHHHHHcTTccHHHHHHHHHHHcHH### DISOP:02AL 300-302| PSIPRED cHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccEEEEEEcccHHHHHHHcccccccEEEEEEcccccccEEEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHcccccEEEEccHHHHHHHHHcccHHHHHHHHcccccHHHEEEEEEccccccccEEEEccccHHHHHHHHHHHHccccccHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHcc //