[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnE.2
DDBJ      :phnE         ABC transporter, membrane spanning protein (phosphonate)
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  235/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:328 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  119->254 2r6gG1  f.58.1.1 * 3e-04 13.5 %
:HMM:PFM   158->315 PF00528 * BPD_transp_1 1.7e-15 20.9 158/185  
:BLT:SWISS 121->264 PHNE_ECOLI 5e-19 37.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85992.2 GT:GENE phnE.2 GT:PRODUCT ABC transporter, membrane spanning protein (phosphonate) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(176435..177421) GB:FROM 176435 GB:TO 177421 GB:DIRECTION - GB:GENE phnE GB:PRODUCT ABC transporter, membrane spanning protein (phosphonate) GB:PROTEIN_ID AAK85992.2 GB:DB_XREF GI:159139526 GB:GENE:GENE phnE LENGTH 328 SQ:AASEQ MATTLHNGTLSPEGLSASSRTVMRHYQQQLATRRIYTVISLVIFLVILAASLNFANAANSGKFFERLPYFFDFMKTFVPDSPLEIFRAMFDLPSPYADGSLKYNYVADRVYITDGFYIPHFIYQLIITLNIALVSTIIGTSFAFVLCFFASTNLVGAGLVRWVVRRVMEVLRAFPEIVVAGLLTAILSIGPIAAIIAISVHTIGALGKLFFEVVENADMKPDEGLRAAGANWLERVRFAIVPQVLPNFVSYALLRAEINVRASTIIGAVGGGGIGEVFRLSIGNDHASKTYAIIILLLITIIAVDQFSSWLRRRLIGQQSFEFGRGAA GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 121->264|PHNE_ECOLI|5e-19|37.1|140/259| TM:NTM 4 TM:REGION 35->57| TM:REGION 129->151| TM:REGION 181->203| TM:REGION 288->310| SEG 48->60|laaslnfanaans| SEG 185->198|ailsigpiaaiiai| SEG 265->275|iigavggggig| SEG 293->302|iiilllitii| HM:PFM:NREP 1 HM:PFM:REP 158->315|PF00528|1.7e-15|20.9|158/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 119->254|2r6gG1|3e-04|13.5|133/284|f.58.1.1| OP:NHOMO 407 OP:NHOMOORG 243 OP:PATTERN ------------------------311-1--1----------------------------------11 --------112--------------1------1-1-1--------2---2--1----3--------1--------2----1------------------------------------------------------------------1--11--2------------1223------11---------------22222222222222224----222----2---------3-22222212222222-2222-2-2222-22222-------2--222---------------------------------------------4---------------------2-----------------------------1111-------225--123244----------2--12-22-3-2--422222222222241111-2-2--341----------------------------------------------------2211-------1111--1111111--111112-----12--21--11121-2------------------1-----33---112------------1--------------------------1-----11--9-----1--------------------------------1-12-1--111-11111-11-111111111121-11-111-2----1--------------2111---1--222222222222----------------22-------------------------2-1121---12-1--1221---------1---1-------1---------------------------------------------1--------1-------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,323-329| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //