[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : phnG
DDBJ      :phnG         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->145 1cmxA PDBj 6e-05 11.5 %
:RPS:PFM   7->152 PF06754 * PhnG 1e-29 48.6 %
:HMM:PFM   10->153 PF06754 * PhnG 1.1e-59 48.6 144/147  
:BLT:SWISS 10->153 PHNG_RHIME 4e-42 58.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86001.1 GT:GENE phnG GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(184477..184938) GB:FROM 184477 GB:TO 184938 GB:DIRECTION - GB:GENE phnG GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86001.1 GB:DB_XREF GI:15155066 GB:GENE:GENE phnG LENGTH 153 SQ:AASEQ MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGGGAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAATRVDFFTMVRGED GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 10->153|PHNG_RHIME|4e-42|58.7|143/156| RP:PDB:NREP 1 RP:PDB:REP 24->145|1cmxA|6e-05|11.5|104/214| RP:PFM:NREP 1 RP:PFM:REP 7->152|PF06754|1e-29|48.6|146/146|PhnG| HM:PFM:NREP 1 HM:PFM:REP 10->153|PF06754|1.1e-59|48.6|144/147|PhnG| GO:PFM:NREP 2 GO:PFM GO:0015716|"GO:phosphonate transport"|PF06754|IPR009609| GO:PFM GO:0019634|"GO:phosphonate metabolic process"|PF06754|IPR009609| OP:NHOMO 124 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111----------1---1--1-1-3--11111111111111-----1----111--------1------------------------------------------------------1111--11111-1---11111---------1---111-------11-------------------11-------------------------------------------------11-------------------------------------------1-11-1-1111111111-111111111111111111-11112----1--------------111----1--1111111-1111---------------------------------------------1111---11-----111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 77.1 SQ:SECSTR #######################TEEEEEEcccccTT#GGGcccccccEEEEE##########EEcccccEEcccccTcHHHHHHHHHHHTcGGGccTTcHHHHHHHHHHHTTcTTHHHTccccccHHHHHHHHHHHTcHHHHHcHHHHHHH# DISOP:02AL 1-10| PSIPRED cccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHccccccHHHcccEEHEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //